Words Containing: E,Y,I
(In Any Order)
There are 12,868 words,
7,940 phrases and
0 abbr's with
E,Y,I in.
Best Scoring Words With: E,Y,I
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| cyclize | 7 | 23 | verbv | |||||
verb • To undergo, or cause to undergo, a reaction resulting in the formation of an aromatic or ring structure. | ||||||||
| enzymic | 7 | 23 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| kyanize | 7 | 23 | verbv | |||||
verb • To preserve wood from decay by soaking it in a solution of mercuric chloride | ||||||||
| liquefy | 7 | 22 | verbv | |||||
verb • become liquid • make (a solid substance) liquid, as by heating • become liquid or fluid when heated | ||||||||
| quivery | 7 | 22 | adjectiveadj | |||||
adjective • Quivering; aquiver | ||||||||
| hexylic | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| fixedly | 7 | 21 | adverbadv | |||||
adverb • in a fixed manner | ||||||||
| cliquey | 7 | 21 | adjectiveadj | |||||
adjective • Having the characteristics of a clique | ||||||||
| pyrexic | 7 | 21 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| jerkily | 7 | 21 | adverb, adjectiveadv, adj | |||||
adverb • with spasms • with jerking motions | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (487)
societyrealitydestinyyellinganytimequietlyheavilylibertywhiskeytestifybicycleanxietyvarietydenyingdaytimebrieflychimneywhitneyhygienesyringedisobeysnidelydensityrelyingbriberyenquirycyanidespecifyimageryfireflymerrilyreadilyhaywireyelpingobesity
...View all with 7 letters...
Phrases (23)
sea lilyin stylethe cityguy wiredie awayslide bywild ryeabide byevil eyehair dye
...View all with 7 letters...
Words (938)
securitydirectlyfriendlydeliveryidentityentirelyterriblyidentifyeternityegyptianunlikelydynamiteslipperysilentlyliterarysidewaysdrivewayideologypolitelyeyesightvineyardequalityyearningvelocityepilepsyserenitycylinderdelicacyseminaryhysteriaregistryfidelityfelicitysteadilyfiercely
...View all with 8 letters...
Phrases (53)
minor keyegg yieldwipe awaylive bodyeye blinkbig moneyin the wayin theorygive awayfile away
...View all with 8 letters...
Words (1334)
boyfriendseriouslycertainlyliterallyterritorypreciselydiscoverytestimonycelebritychemistryspeciallylifestylespecialtysincerelyintegritycertaintymysteriesmachinerysexualityartilleryillegallyinventoryprivatelyhypocriteevidentlynecessityintensitysinceritymentalitygenuinelyseeminglydiversitysyntheticmaternityhairstyle
...View all with 9 letters...
Phrases (117)
by machinedirect dyehigh stylehyoid boneitchy feetlike crazygrey friargin rickeyhair dryeregg laying
...View all with 9 letters...
Words (1665)
everythingdefinitelyespeciallyuniversitymysteriousincrediblypreviouslyultimatelyterrifyinghystericalbabysitterrelativelyprosperitygenerositycreativityfraternitypositivelytypewriterdisneylandmayonnaiseefficiencyeyewitnesshypothesispresidencyinevitablyhypnotizedhereditaryspecialitycomplexityinsecurityinfidelitysympathizetestifyingunderlyingdiscreetly
...View all with 10 letters...
Phrases (210)
hindu deityepoxy resinprivate eyeby the piecebody weightenergy unitline of dutyfamily linemt. mckinleyfield pansy
...View all with 10 letters...
Words (1949)
immediatelyelectricityanniversarypersonalitydifferentlynecessarilytechnicallyessentiallycountrysidebeautifullyemotionallytemporarilypreliminarypotentiallycredibilitysympatheticsensitivitygeneticallyeffectivelyexclusivelyheavyweightuncertaintydaydreamingsovereigntyidentifyingmomentarilybeneficiaryflexibilitysuperiorityrespiratoryreactionaryconsistencysymmetricalmercilesslycontingency
...View all with 11 letters...
Phrases (323)
genus myxinelaying wastelouis leakeysilver berrymighty mouseelinor wyliebulb syringespiny puffersensory hairsingle entry
...View all with 11 letters...
Words (1835)
specificallyaccidentallydeliberatelyincreasinglypennsylvaniaincidentallyunbelievablyevolutionaryindefinitelypassionatelysufficientlypenitentiarymysteriouslyconsiderablygynecologistencyclopediaconsistentlysynchronizedhypotheticalaggressivelyeconomicallydefinitivelyauthenticitycollectivelyconvenientlymetaphysicalstorytellingconstituencyhystericallyperiodicallyintermediarybiochemistrymeticulouslytechnicalityfiguratively
...View all with 12 letters...
Phrases (422)
woody guthriemolly pitcherstaying powergenus glycinelickety splitwilliam wyleradmiral deweyread-only filehockey clinicsquirrel away
...View all with 12 letters...
Words (1593)
extraordinaryrevolutionaryapproximatelyunnecessarilyintentionallytheoreticallyhomosexualityexceptionallyindependentlyinstinctivelyvulnerabilityinterestinglyappropriatelycomplimentaryparliamentaryinadvertentlyprogressivelyhieroglyphicsgynaecologistrealisticallyprecautionarystrategicallypredominantlyexponentiallycategoricallyphysiotherapyintelligentlyfrighteninglycomparativelyirretrievablymagnificentlyalternativelynitroglycerineverlastinglyhyperhidrosis
...View all with 13 letters...
Phrases (548)
harvey cushingaleatory musicel iskandriyahfamily laridaevaginal arterydirect antonymauditory sensegilbert murraybitter hickoryfamily picidae
...View all with 13 letters...
Words (1174)
responsibilitysimultaneouslyprofessionallyscientificallyhypotheticallycinematographysystematicallyintellectuallycoincidentallymetaphoricallyaffectionatelyelectronicallydemocraticallyoverwhelminglysentimentalitymathematicallyrespectabilitygeographicallyhypersensitivealphabeticallyunquestionablyintentionalitycytogeneticistinterplanetaryphotosynthesisconfidentiallythermodynamicsterritorialityhyperventilatenitroglycerineexcruciatinglyintermittentlyconservativelyconventionallypredictability
...View all with 14 letters...
Phrases (642)
family apiaceaepearl mae baileyfield intensitymoonseed familyorder mysidaceawilliam tyndaledimethyl ketonefamily ardeidaehigh technologyveliky novgorod
...View all with 14 letters...
Words (824)
confidentialityextraordinarilyinternationallypsychotherapisttechnologicallyunintentionallyinstantaneouslyenvironmentallyinappropriatelyanaesthesiologydisrespectfullyphysiotherapistheterosexualityconscientiouslysympathomimeticsynergisticallyinaccessibilityoversimplifyingintellectualitysurreptitiouslyparentheticallyplenipotentiarycondescendinglyaerodynamicallyproportionatelymaneuverabilitytherapeuticallyinfinitesimallyinstrumentalityinvulnerabilitycontroversiallysuccinylcholineneurophysiologycytomegaloviruscompassionately
...View all with 15 letters...
Phrases (800)
auditory ossiclestay of executionbenefit of clergyalimentary pasteasamiya languagehelen wills moodydialysis machinefamily tinamidaefamily lemnaceaeadvisory service
...View all with 15 letters...
Words (337)
enthusiasticallyindiscriminatelyirresponsibilityhemorrhoidectomyincomprehensiblytriphenylmethanehyperintelligentunpredictabilityhyperventilationquintessentiallyphylogeneticallyimperceptibilitynonrevolutionarypharmaceuticallyerythroblastosisunapologeticallythermostaticallysurrealisticallyincontrovertiblythrombocytopeniaelectrochemistryhypersensitivityunprofessionallyinconceivabilityconversationallyneuropsychiatricpolydispersitieshypersalivationsinextinguishablycolorimetricallyexterritorialitythermometricallyparamagneticallytrinitroglycerincommensurability
...View all with 16 letters...
Phrases (721)
hypodermic needletympanic membranein a beastly manneritalian greyhoundstrictly speakingfamily cyperaceaechristian huygensfamily cyprinidaedefinite quantitywilliam wycherley
...View all with 16 letters...
Words (207)
counterinsurgencyunconventionalitybacteriologicallysuperconductivityparathyroidectomymaterialisticallycardiorespiratoryneurophysiologistelectrostaticallythermodynamicallyinconsequentiallysocioeconomicallypsychotherapeuticinterdisciplinaryantirevolutionaryhyperreactivitiesself-contradictoryisoelectronicallyphysiotherapeuticcercidiphyllaceaeunexchangeabilitythermoperiodicitykaleidoscopicallyspondylolisthesishyperstimulationsspectroscopicallyhyperventilationsnonprofessionallyhypnotizabilitiesthrombocytopeniaschlortetracyclinemonosyllabicitiespaternalisticallyhypophysectomizespathophysiologies
...View all with 17 letters...
Phrases (719)
mary leontyne pricesalvia leucophyllabalaena mysticetusczech monetary unitproteolytic enzymehypoglycemic agentcuban monetary unitinterstate highwaypearly everlastingfamily dasypodidae
...View all with 17 letters...
Words (105)
characteristicallydisproportionatelyinconsequentialityhypercoagulabilityhyperaldosteronisminterchangeabilityneuropsychologicalhypersensitivenesspolyesterificationhypersensitivitieshypersensitizationspectroheliographypolyribonucleotidenoncomprehensivelypsychotherapeuticssphygmomanometrieshypophysectomizinghyposensitizationsanthropocentricitycylindrical-stemmedlipopolysaccharidetriphosphopyridinelymphangiographieshyperbilirubinemiastereospecificallyimmunocytochemicalcalymmatobacteriumstoichiometricallypteridospermaphytadiethylmalonylurearecrystallizationsdiethylstilbestrolcounterintuitivelymucopolysaccharidehypercholesteremia
...View all with 18 letters...
Phrases (698)
bombycilla cedrorunworldly possessionsrevolutionary groupadministrative bodyfamily physeteridaedame sybil thorndikeeriobotrya japonicalachrymal secretionfreudian psychologyposterior pituitary
...View all with 18 letters...
Words (79)
hyperparathyroidismhydrochlorothiazidecinematographicallypolyesterificationshypersensitizationsextralinguisticallypolyribonucleotidesextraterritorialityhypersusceptibilityparathyroidectomieshypolipoproteinemiaparthenogeneticallynonrelativisticallymucopolysaccharideslipopolysaccharidescytodifferentiationconceptualisticallycytopathogenicitiesimmunocytochemistrydiethylstilbesteroldiethylstilboestrolbacteriochlorophyllmagnetohydrodynamicphenomenalisticallyphenylthiocarbamidedehydrochlorinatingdehydrochlorinationphosphatidylcholinemercury-contaminatedinterconvertibilityinterdepartmentallyelectromagneticallycontradistinctivelyelectromechanicallythird-dimensionality
...View all with 19 letters...
Phrases (615)
building supply housewater-plantain familyacetylsalicylic acidfamily cyclopteridaejohn millington syngefamily cynoglossidaeitalian monetary unithydrastis canadensislatvian monetary unitmillimeter of mercury
...View all with 19 letters...
Words (44)
counterrevolutionaryuncharacteristicallyhypercholesterolemiaoverenthusiasticallytetrahydrocannabinolhypersensitivenessespolyphiloprogenitiveradioimmunoassayableparathyroidectomizedhyperadrenocorticismcytodifferentiationsimmunocytochemicallymagnetofluiddynamicsbacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesneurophysiologicallyneuropsychiatricallyhyperlipoproteinemiamagnetohydrodynamicselectrophysiologicalelectrophysiologistsdeoxyribonucleotidesmicrocrystallinitiesimmunohistochemistryroentgenographicallyencephalomyocarditischemotherapeuticallyhydrochlorothiazidespsychopharmacologiesmicrophotometrically
...View all with 20 letters...
Phrases (499)
william stanley jevonshonduran monetary unityellow-shafted flickerwyethia amplexicaulisorder mycelia steriliafamily phytolaccaceaemalawian monetary unitlebanese monetary unitorder myxobacterialesfamily trachipteridae
...View all with 20 letters...
Words (14)
hypogammaglobulinemiahypersusceptibilitiesstereomicroscopicallyimmunocytochemistriesacetylcholinesterasesotorhinolaryngologieselectromyographicallydendrochronologicallypolyvinyl-formaldehydeintersubstitutabilityantiferromagneticallyhypercholesterolemiaspsychotherapeuticallytetrahydrocannabinolsPhrases (353)
icelandic monetary unitelectrolytic condenseraleksandr solzhenitsynmalaysian monetary unithelichrysum bracteatumbulgarian monetary unitdesoxyribonucleic acidhungarian monetary unitsri lankan monetary unitextrauterine pregnancy
...View all with 21 letters...
Words (7)
spectrophotometricallyintercomprehensibilityelectrophysiologicallyhexamethylenetetramineencephalomyocarditisesdihydroxyphenylalaninemicrospectrophotometryPhrases (308)
venezuelan monetary unitlycopersicon esculentumhaliaeetus leucorhyphusredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynfamily dendrocolaptidaemultiple mononeuropathyloyalist volunteer force
...View all with 22 letters...
Words (2)
hexamethylenetetramineshypobetalipoproteinemiaPhrases (207)
family threskiornithidaeposterior pituitary glandmeperidine hydrochlorideyellowstone national parkkazakhstani monetary unitcalycanthus occidentalisparis-sorbonne universityinterlocutory injunctionkyrgyzstani monetary unitbangladeshi monetary unit
...View all with 23 letters...
Words (6)
laryngotracheobronchitishyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolaminemicroelectrophoreticallyschizosaccharomycetaceaePhrases (150)
carnegie mellon universitylouis seymour bazett leakeyargyroxiphium sandwicensesubdivision deuteromycotadivision heterokontophytamary wollstonecraft godwinunidentified flying objectprivately held corporationzollinger-ellison syndromeprimary sex characteristic
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (113)
myroxylon balsamum pereiraediamond wedding anniversaryfrancis scott key fitzgeraldcentral intelligence agencymodest petrovich mussorgskyedmund john millington syngepropoxyphene hydrochloridepolystichum acrostichoidesreligious society of friendsbeggar-my-neighbour strategy
...View all with 25 letters...
Phrases (85)
brassica oleracea gongylodeshunting and gathering societyhuman immunodeficiency virussecretary of veterans affairsemployee stock ownership planevelyn arthur saint john waughassyrian neo-aramaic languagecharles maurice de talleyrandrevolutionary calendar monthsubdivision coniferophytina
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (70)
business environment analysisamerican revolutionary leadernikita sergeyevich khrushchevholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinaugustus welby northmore puginco-operative republic of guyanacommissioned military officernuclear regulatory commission
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (56)
revolutionary people's strugglealeksandr feodorovich kerenskyephippiorhynchus senegalensistriphosphopyridine nucleotideoxytetracycline hydrochloridemarcus junius brutus the youngerfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationmicrosoft disk operating system
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (36)
business environmental analysisaleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitscrutin uninominal voting systeminternational olympic committeemiddle east respiratory syndrome
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (33)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligencedepository financial institutionethylenediaminetetraacetic acidbalance of international payments
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (21)
great smoky mountains national parkfreedom from involuntary servitudedigital communications technology2019-ncov acute respiratory diseasetupac amaru revolutionary movementrevolutionary proletarian nucleusdiego rodriguez de silva y velazquezprimary subtractive color for lightrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyer
...View all with 31 letters...
Phrases (24)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory druguniversity of california at berkeley
...View all with 32 letters...
Phrases (17)
autonomous sensory meridian responselycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human serviceshighly active antiretroviral therapy
...View all with 33 letters...
Phrases (11)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesdryopithecus rudapithecus hungaricusmassachusetts institute of technologyeinstein's general theory of relativityeinstein's special theory of relativitygymnosporangium juniperi-virginianaecomputerized axial tomography scanner
...View all with 34 letters...
Phrases (11)
communications security establishmentrevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence serviceimmaculate conception of the virgin maryhereditary motor and sensory neuropathynational socialist german workers' partyfraxinus pennsylvanica subintegerrimasecurity intelligence review committee
...View all with 35 letters...
Phrases (9)
jakob ludwig felix mendelssohn-bartholdyangiotensin-converting enzyme inhibitorchurch of jesus christ of latter-day saintsnational geospatial-intelligence agencyjuan carlos victor maria de borbon y borbonfield-sequential color television systemtransportation security administrationsecretary of health education and welfaresocialist people's libyan arab jamahiriyaPhrases (13)
severe combined immunodeficiency diseasefirst epistle of paul the apostle to timothyuniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and scienceskarl friedrich hieronymus von munchhausen
...View all with 37 letters...
