Words Containing: E,Y,E,I
(In Any Order)
There are 3,747 words,
4,296 phrases and
0 abbr's with
E,Y,E,I in.
Best Scoring Words With: E,Y,E,I
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| eyewink | 7 | 17 | verb, nounv, n | |||||
Valid word for Scrabble US
| ||||||||
| pinkeye | 7 | 16 | nounn | |||||
noun • inflammation of the conjunctiva of the eye | ||||||||
| fisheye | 7 | 16 | noun, adjectiven, adj | |||||
adjective • of or relating to a fisheye lens | ||||||||
| weevily | 7 | 16 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| beefily | 7 | 15 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| hygiene | 7 | 14 | nounn | |||||
noun • a condition promoting sanitary practices • the science concerned with the prevention of illness and maintenance of health | ||||||||
| reedify | 7 | 14 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| eyelike | 7 | 14 | adjectiveadj | |||||
adjective satellite • suggesting an eye or eyes | ||||||||
| weedily | 7 | 14 | adverbadv | |||||
Valid word for Scrabble US
| ||||||||
| yippee | 6 | 13 | ||||||
interjection • Used to express joy or elation. | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
eyrieWords (43)
hygienepinkeyefisheyesyenitemyelineseedilyreedifyreedilyneedilyeyelikeeyelidsleerilyyieldedweevilybigeyesyeelinsyieldereyeliftbeefilyweedilyeyewinkhyenineyperiteweepilyerinyeskeylineskieyeryeniseiyeniseywheyieryeedingebrietyeyeliadmenyiesdyeline
...View all with 7 letters...
Phrases (2)
evil eyekey limeWords (113)
deliveryentirelyeternityeyesightepilepsyserenityfiercelyseverityeyelinerrefineryentiretyleniencyeurydicethieveryheredityyuletidetemerityspeedilygreedilyeyepiececheerilyyosemitebiweeklysleepilyreverifyepiphytecheekilyeminencywheezilyexigencykeffiyehceleritylegerityepistyleredyeing
...View all with 8 letters...
Phrases (6)
egg yieldeye blinkmagic eyeevery bitthird eyemind's eyeWords (225)
preciselycelebritylifestylesincerelymysteriesevidentlynecessitygenuinelyseeminglyintenselyimmenselyresidencyexcitedlyleisurelydexteritydecidedlyindecencyglycerineperipherykimberleyextremitykeynesianeminentlyelectrifyeyestraininverselyfeelinglytypewritejellylikesystemizehyperemiahyperemicspeechifyremedyingpensively
...View all with 9 letters...
Phrases (26)
direct dyeitchy feetivy leaguequeen cityriver tyneelihu yaletyne riverevery inchde quinceynellie bly
...View all with 9 letters...
Words (357)
everythingdefinitelyespeciallyrelativelygenerositytypewriterefficiencyeyewitnesspresidencyhereditarydiscreetlydeficiencyveterinaryinherentlyembroiderynegativelydelicatelycreativelytirelesslyperpetuitydiscretelycyberneticdecisivelysynthesizeperversityindecentlysheepishlyepicondylefeverishlyobedientlybelievablylifelesslysystemizedtiresomelysynthesise
...View all with 10 letters...
Phrases (64)
epoxy resinprivate eyeby the pieceenergy unitaniline dyeyemeni rialisle of skyegreek deityivy leaguerleydig cell
...View all with 10 letters...
Words (548)
immediatelyelectricitydifferentlynecessarilyessentiallygeneticallyeffectivelyexclusivelyheavyweightsovereigntybeneficiarymercilesslyexceedinglyexcessivelyefficientlypsychedelicobjectivelysynthesizerhyperactivedelinquencyextensivelyattentivelyobsessivelyeventualityexquisitelyserendipityevidentiaryselectivelysedimentaryequivalencydeliverymanintensivelydeceitfullydeceptivelysynesthesia
...View all with 11 letters...
Phrases (95)
genus myxinelouis leakeysilver berryelinor wyliesingle entrybicycle racebicycle seatmystic jewelaeolian lyreheavy hitter
...View all with 11 letters...
Words (608)
deliberatelyunbelievablyindefinitelypenitentiaryencyclopediaaggressivelydefinitivelycollectivelyconvenientlyintermediarytriglyceridehypertensionrespectivelylegitimatelyelectrifyingperipherallypresbyterianincoherentlyelectricallypersistentlyrefreshinglytheophyllinehypertensiveeccentricityinadequatelyelectrolysisinefficiencybelligerencyphylogeneticpejorativelyhermeticallyimpressivelyinfrequentlyhypothesizedstereotyping
...View all with 12 letters...
Phrases (139)
genus glycineadmiral deweyread-only fileathletic typechinese deitybicycle wheellienal arteryyenisey riverdevil-may-carerisky venture
...View all with 12 letters...
Words (563)
unnecessarilytheoreticallyexceptionallyindependentlyinterestinglyinadvertentlyprogressivelyexponentiallyintelligentlyirretrievablyalternativelyeverlastinglystereotypicalconsecutivelyexpeditionarybelievabilityaestheticallyimperceptiblyconfectioneryencyclopaediaindifferentlyenergeticallyhydroelectricdependabilitycompetitivelypredominatelyeccentricallysentimentallyhypercalcemiadeoxygenationinsensitivelyincompetentlypicturesquelyineffectuallyinefficiently
...View all with 13 letters...
Phrases (211)
auditory senseinventory itemhydrated oxidespiny anteaterprivate treatyfamily poaceaecooley's anemiaacrylate resinradiant energyjapanese deity
...View all with 13 letters...
Words (522)
intellectuallyaffectionatelyelectronicallyoverwhelminglysentimentalityrespectabilityhypersensitivecytogeneticistinterplanetaryhyperventilatenitroglycerineintermittentlyconservativelychemosynthesisexperimentallymetempsychosistelepathicallyreproductivelyinconvenientlyappreciativelyappendicectomyintermediatelyentertaininglydifferentiallypyelonephritisinterferometrydemythologisedmysteriousnesstelephonicallypreferentiallychemosyntheticanesthesiologybioelectricityextortionatelyoverpoweringly
...View all with 14 letters...
Phrases (256)
family apiaceaepearl mae baileyfield intensitymoonseed familyorder mysidaceadimethyl ketonefamily ardeidaepolymeric amidecooley's anaemiaprimary feather
...View all with 14 letters...
Words (347)
environmentallyanaesthesiologydisrespectfullyheterosexualityintellectualityparentheticallyplenipotentiarycondescendinglymaneuverabilitytherapeuticallymethylphenidatestereochemistryphotosynthesizepostoperativelyintrospectivelyuninterruptedlydemonstrativelyretrospectivelyunceremoniouslyheartbreakinglyinconsideratelyeuphemisticallycomprehensivelydiphenhydramineinterdependencyinterrogativelysymmetricalnessperpendicularlyoxytetracyclinekinestheticallyhypersensitizedcentrosymmetricinteruniversitysemidocumentarycontemplatively
...View all with 15 letters...
Phrases (368)
stay of executionbenefit of clergyalimentary pastehelen wills moodyfamily lemnaceaeadvisory servicefamily arecaceaeprivate propertysystem of weightsfamily leporidae
...View all with 15 letters...
Words (153)
hemorrhoidectomyincomprehensiblytriphenylmethanehyperintelligenthyperventilationquintessentiallyphylogeneticallyimperceptibilityelectrochemistryhypersensitivitypolydispersitiesexterritorialitythermometricallyhypersensitizingmicrogametophytenoncompetitivelyhypersexualitiesimperfectibilityantiunemploymenthypersusceptibledimethylglyoximehyperventilatinghyperviscositieshypervitaminoseshypophysectomiesthyroidectomizedhypophysectomiseleukodystrophiesperpendicularityhypophysectomizecryopreservationferroelectricitylyginopteridalesstereophonicallyecclesiastically
...View all with 16 letters...
Phrases (397)
hypodermic needletympanic membranein a beastly mannerfamily cyperaceaedefinite quantitywilliam wycherleyin an elaborate wayefficiency expertamerican sycamorecommercial agency
...View all with 16 letters...
Words (92)
counterinsurgencyelectrostaticallyinconsequentiallypsychotherapeutichyperreactivitiesisoelectronicallyphysiotherapeuticcercidiphyllaceaeunexchangeabilitythermoperiodicityhyperventilationschlortetracyclinehypophysectomizeshypophysectomisedferrimagneticallymorphogeneticallyhypophysectomizedcryopreservationsencephalomyelitisdisrespectabilitylymphadenopathieshyperalimentationcytomegalovirusesstereospecificitytrichloroethyleneimmunogeneticallyelectronegativitythiodiphenylaminephenylethylamineselectroanalyticalnephelometricallyelectrochemicallyacetylsalicylatesdehydrochlorinasesamoyedic-speaking
...View all with 17 letters...
Phrases (422)
mary leontyne pricebalaena mysticetusczech monetary unitproteolytic enzymehypoglycemic agentinterstate highwaypearly everlastingtheological systemotto fritz meyerhofcylinder separator
...View all with 17 letters...
Words (59)
inconsequentialityhyperaldosteronisminterchangeabilityhypersensitivenesspolyesterificationhypersensitivitieshypersensitizationspectroheliographypolyribonucleotidenoncomprehensivelypsychotherapeuticssphygmomanometriescylindrical-stemmedhyperbilirubinemiastereospecificallypteridospermaphytadiethylmalonylureadiethylstilbestrolcounterintuitivelyhypercholesteremiamagnetostrictivelymyeloproliferativephenomenologicallyhydroflumethiazidedehydrochlorinasesdehydrochlorinateddehydrochlorinatesneuroendocrinologytrichloroethylenesgranulocytopoiesespolypropenonitrileaerothermodynamicsrepresentationallyelectromyographieselectrophysiologic
...View all with 18 letters...
Phrases (435)
family physeteridaedame sybil thorndikelachrymal secretionclass schizomycetesread-only memory chipkilocycle per secondfamily trichechidaesuperiority complexfamily asparagaceaefamily desmidiaceae
...View all with 18 letters...
Words (47)
polyesterificationshypersensitizationspolyribonucleotidesextraterritorialityhypersusceptibilityparathyroidectomieshypolipoproteinemiaparthenogeneticallycytodifferentiationcytopathogenicitiesdiethylstilbesteroldiethylstilboestrolphenomenalisticallyphenylthiocarbamidemercury-contaminatedinterconvertibilityinterdepartmentallyelectromagneticallyelectromechanicallyinterferometricallythree-dimensionalityelectrophoreticallymethylprednisoloneselectrophysiologieselectrophysiologistdeoxyribonucleotideelectroretinographyincomprehensibilitymicroelectronicallyencephalomyelitidesphenylpropanolaminehydroxytetracyclinehydrometeorologicalhydrometeorologistsoverproportionately
...View all with 19 letters...
Phrases (378)
family cyclopteridaemillimeter of mercuryalpine type of glaciergiles lytton stracheyfamily lepisosteidaezairese monetary unitnancy freeman mitfordfamily tropaeolaceaefamily polypodiaceaechinese monetary unit
...View all with 19 letters...
Words (25)
counterrevolutionaryhypercholesterolemiaoverenthusiasticallyhypersensitivenessespolyphiloprogenitiveparathyroidectomizedhyperadrenocorticismcytodifferentiationsphenylpropanolaminesphenylthiocarbamidesacetylcholinesterasehyperlipoproteinemiaelectrophysiologicalelectrophysiologistsdeoxyribonucleotidesroentgenographicallyencephalomyocarditischemotherapeuticallysyncategorematicallyhypercholesterolemichypercoagulabilitieshyperconsciousnessesdimethylnitrosaminesheterobasidiomycetesexistentialisticallyPhrases (343)
william stanley jevonsyellow-shafted flickerwyethia amplexicaulisorder mycelia steriliafamily phytolaccaceaelebanese monetary unitorder myxobacterialesfamily trachipteridaebalance sheet analysisfamily dermochelyidae
...View all with 20 letters...
Words (9)
hypersusceptibilitiesstereomicroscopicallyimmunocytochemistriesacetylcholinesteraseselectromyographicallypolyvinyl-formaldehydeantiferromagneticallyhypercholesterolemiaspsychotherapeuticallyPhrases (242)
icelandic monetary unitelectrolytic condenseraleksandr solzhenitsynhelichrysum bracteatumdesoxyribonucleic acidextrauterine pregnancybyzantine architecturepseudemys rubriventriseucalyptus fraxinoidesnorwegian monetary unit
...View all with 21 letters...
Words (7)
spectrophotometricallyintercomprehensibilityelectrophysiologicallyhexamethylenetetramineencephalomyocarditisesdihydroxyphenylalaninemicrospectrophotometryPhrases (218)
venezuelan monetary unitlycopersicon esculentumhaliaeetus leucorhyphusredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynfamily dendrocolaptidaemultiple mononeuropathyloyalist volunteer force
...View all with 22 letters...
Words (2)
hexamethylenetetramineshypobetalipoproteinemiaPhrases (135)
family threskiornithidaemeperidine hydrochlorideyellowstone national parkparis-sorbonne universitybangladeshi monetary unitsouth korean monetary unittyrosine kinase inhibitorrichard brinsley sheridangroup pteridospermaphytatricyclic antidepressant
...View all with 23 letters...
Words (5)
hyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolaminemicroelectrophoreticallyschizosaccharomycetaceaePhrases (114)
carnegie mellon universitylouis seymour bazett leakeyargyroxiphium sandwicensesubdivision deuteromycotadivision heterokontophytaunidentified flying objectprivately held corporationzollinger-ellison syndromeprimary sex characteristicsir terence mervyn rattigan
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (92)
myroxylon balsamum pereiraediamond wedding anniversaryfrancis scott key fitzgeraldcentral intelligence agencymodest petrovich mussorgskyedmund john millington syngepropoxyphene hydrochloridereligious society of friendsbeggar-my-neighbour strategytrans-alaska pipeline system
...View all with 25 letters...
Phrases (70)
brassica oleracea gongylodeshunting and gathering societyhuman immunodeficiency virussecretary of veterans affairsemployee stock ownership planevelyn arthur saint john waughassyrian neo-aramaic languagecharles maurice de talleyrandrevolutionary calendar monthnewton's theory of gravitation
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (55)
business environment analysisamerican revolutionary leadernikita sergeyevich khrushchevholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinaugustus welby northmore puginco-operative republic of guyanacommissioned military officernuclear regulatory commission
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (47)
revolutionary people's strugglealeksandr feodorovich kerenskyephippiorhynchus senegalensistriphosphopyridine nucleotideoxytetracycline hydrochloridemarcus junius brutus the youngermicrosoft disk operating systemfeodor mikhailovich dostoevskydepartment of homeland securitymaster of arts in library science
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (32)
business environmental analysisaleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitinternational olympic committeemiddle east respiratory syndromeunited arab emirate monetary unit
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (30)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligenceethylenediaminetetraacetic acidbalance of international paymentswaterhouse-friderichsen syndrome
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (16)
freedom from involuntary servitude2019-ncov acute respiratory diseasetupac amaru revolutionary movementrevolutionary proletarian nucleusdiego rodriguez de silva y velazquezrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyerinternational atomic energy agencymarie anne charlotte corday d'armontinternational intelligence agency
...View all with 31 letters...
Phrases (18)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylateuniversity of california at berkeleytheory of electrolytic dissociation
...View all with 32 letters...
Phrases (15)
autonomous sensory meridian responselycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavaright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human serviceshighly active antiretroviral therapyinternational law enforcement agency
...View all with 33 letters...
Phrases (11)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesdryopithecus rudapithecus hungaricusmassachusetts institute of technologyeinstein's general theory of relativityeinstein's special theory of relativitygymnosporangium juniperi-virginianaecomputerized axial tomography scanner
...View all with 34 letters...
Phrases (11)
communications security establishmentrevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence serviceimmaculate conception of the virgin maryhereditary motor and sensory neuropathynational socialist german workers' partyfraxinus pennsylvanica subintegerrimasecurity intelligence review committee
...View all with 35 letters...
Phrases (11)
severe combined immunodeficiency diseasefirst epistle of paul the apostle to timothyuniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentacademy of motion picture arts and scienceskarl friedrich hieronymus von munchhausensixteen personality factor questionnaire
...View all with 37 letters...
