Words Containing: E,Y,A
(In Any Order)
There are 12,769 words,
9,335 phrases and
1 abbr with
E,Y,A in.
Best Scoring Words With: E,Y,A
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| queazy | 6 | 27 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| cachexy | 7 | 24 | nounn | |||||
noun • any general reduction in vitality and strength of body and mind resulting from a debilitating chronic disease | ||||||||
| squeaky | 7 | 23 | adjectiveadj | |||||
adjective satellite • having or making a high-pitched sound such as that made by a mouse or a rusty hinge | ||||||||
| kyanize | 7 | 23 | verbv | |||||
verb • To preserve wood from decay by soaking it in a solution of mercuric chloride | ||||||||
| quavery | 7 | 22 | adjectiveadj | |||||
adjective • Apt to quaver; shaky, trembling. | ||||||||
| exarchy | 7 | 22 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| hazelly | 7 | 22 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| mazedly | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| equably | 7 | 21 | adverbadv | |||||
adverb • in an equable manner | ||||||||
| zymases | 7 | 21 | nounn | |||||
noun • a complex of enzymes that cause glycolysis; originally found in yeast but also present in higher organisms | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (402)
reallyanyoneplayedlawyerbeautynearlyplayerlatelyeasilysafetybarelyagencyvalleynearbyprayersteadybetraysafelyharveydeadlyrarelylegacyfreakydearlyvoyagebarneyyankeesweatybaileybakerytreatysneakyarterygreasysawyer
...View all with 6 letters...
Phrases (11)
red baytab keytype abso yeahleg dayvat dyee layerazo dyef layerday bed
...View all with 6 letters...
Words (746)
alreadyexactlyanymorerealityclearlymajestygermanyhealthysomedaytuesdaytherapyanytimebatterytragedyacademypaymentheavilypenaltystanleyembassygalleryanxietywealthylegallyequallydelayedvarietyecstasygreatlyannoyedbradleydaytimeslaveryanalyzebravery
...View all with 7 letters...
Phrases (63)
by heartheat raysea lilyred claybaby bedzea mayspay ratebay leafeye maskhay bale
...View all with 7 letters...
Words (1172)
anywhereeverydayattorneystrategyfebruarymentallyegyptianassemblysexuallyheavenlyjealousybetrayaldynamiterosemarycategorytreasurykeyboardliterarypaychecksidewaysdrivewayunderwayadulteryvineyardequalityjeopardysyllableyearninganalyzedmonetaryyearbookforeplaydelicacyseminaryanyplace
...View all with 8 letters...
Phrases (141)
mary janeby naturesea nymphdry cleanfeast dayzane greyvery fastjenny assbaby shoecat thyme
...View all with 8 letters...
Words (1515)
yesterdaycertainlynecessarycarefullysecretaryliterallywednesdaytemporarydemocracygenerallypregnancyspeciallylegendaryspecialtyregularlystrangelygraveyardsecondarycertaintymonasteryparalyzedmachinerysexualityartilleryillegallyprivatelyhyderabadgeographymentalityraspberrysynagoguematernityhairstyleallegedlyeternally
...View all with 9 letters...
Phrases (238)
by machinerate of paybon voyagelake nyasaholy placebody wastelike crazyprayer matprayer rugready cash
...View all with 9 letters...
Words (1625)
absolutelyespeciallyapparentlypersonallyeventuallyultimatelystrawberryscreenplayhystericalelementarypeacefullybabysitterrelativelyrepeatedlyseparatelycreativityfraternitymelancholyvolleyballdisneylandapocalypsemayonnaisepreferablypresumablytrajectoryaccuratelyremarkablyinevitablycommentaryhereditaryreasonablyhyperspacespecialitysympathizedehydrated
...View all with 10 letters...
Phrases (395)
yves tanguywoody allenmary leakeybrya ebenusprivate eyebrandy nosehoney eaterfamily linemoshe dayanfield pansy
...View all with 10 letters...
Words (1670)
immediatelyanniversarypersonalitynecessarilytechnicallydocumentaryfortunatelyessentiallybeautifullydesperatelyunnecessaryemotionallytemporarilypreliminarypotentiallypermanentlysympatheticgeneticallyheavyweightuncertaintyobservatorydaydreamingdangerouslymomentarilybeneficiaryrespiratoryreactionaryarchaeologysymmetricalbureaucracyprematurelyreformatoryhypothermiaregrettablydehydration
...View all with 11 letters...
Phrases (476)
genus lycosalaying wastebody of waterlouis leakeybody servantgenus styraxmary shelleyroentgen rayhoney badgersensory hair
...View all with 11 letters...
Words (1601)
specificallyaccidentallydeliberatelyincreasinglycontemporarypennsylvaniaincidentallychemotherapyunbelievablyevolutionarypassionatelypenitentiaryconservatorychoreographyconsiderablyencyclopediahypotheticalaggressivelyeconomicallyauthenticitymetaphysicalformaldehydehystericallyperiodicallyintermediarytechnicalitytransparencyfigurativelycommerciallypatheticallyaerodynamicsinexplicablyclytemnestrahydrothermalcourageously
...View all with 12 letters...
Phrases (584)
mary magdalenbackspace keystaying powerwilliam wylerrandom memoryadmiral deweyread-only fileearnest moneysquirrel awayhockey league
...View all with 12 letters...
Words (1397)
unfortunatelyextraordinaryrevolutionaryapproximatelyunnecessarilyintentionallytheoreticallyhomosexualityexceptionallyfundamentallyspontaneouslyvulnerabilityappropriatelycomplimentaryparliamentaryinadvertentlychrysanthemumgynaecologistpsychotherapyrealisticallyprecautionarystrategicallypredominantlyexponentiallycategoricallyphysiotherapyspectacularlycomparativelycomplementaryirretrievablymagnificentlyalternativelysupplementaryeverlastinglystereotypical
...View all with 13 letters...
Phrases (685)
harvey cushingaleatory musicel iskandriyahfamily laridaevaginal arterydirect antonymauditory sensesecond balconygilbert murrayfamily picidae
...View all with 13 letters...
Words (1004)
simultaneouslyprofessionallyscientificallyhypotheticallycinematographysystematicallyintellectuallycoincidentallymetaphoricallywholeheartedlyaffectionatelyunderstandablyelectronicallydemocraticallysentimentalitymathematicallyrespectabilitygeographicallyalphabeticallynanotechnologyunquestionablyintentionalityinterplanetaryundersecretarypancreatectomyconfidentiallythermodynamicsterritorialityelectrotherapyhyperventilateexcruciatinglyconservativelyconventionallypredictabilitycharacterology
...View all with 14 letters...
Phrases (760)
family apiaceaepearl mae baileyanthony burgessbattle of nasebymoonseed familyanthony vandykeorder mysidaceawilliam tyndalefamily ardeidaetubal pregnancy
...View all with 14 letters...
Words (731)
confidentialityextraordinarilyinternationallypsychotherapisttechnologicallyunintentionallyinstantaneouslyenvironmentallyinappropriatelyanaesthesiologyphysiotherapistheterosexualitysympathomimeticlymphadenopathysynergisticallyinaccessibilitydevelopmentallyintellectualityparentheticallyplenipotentiaryaerodynamicallyproportionatelymaneuverabilitytherapeuticallyinfinitesimallyinstrumentalityinvulnerabilitycontroversiallycytomegaloviruscompassionatelyuncomplimentarymethylphenidaterecrystallizingencephalographypostoperatively
...View all with 15 letters...
Phrases (899)
auditory ossiclestay of executioncentaurea cyanuscharlotte cordayclass pelecypodaalimentary pasteasamiya languagedialysis machinefamily tinamidaemrs. humphrey ward
...View all with 15 letters...
Words (301)
enthusiasticallyindiscriminatelypheochromocytomatriphenylmethaneunpredictabilityhyperventilationquintessentiallyphylogeneticallynonrevolutionaryelectromyographypharmaceuticallysphygmomanometererythroblastosisextemporaneouslyunapologeticallythermostaticallysurrealisticallythrombocytopeniaunprofessionallyinconceivabilityconversationallyneuropsychiatrichypersalivationsinextinguishablyheterokontophytahymenophyllaceaecolorimetricallyexterritorialityparaformaldehydethermometricallyextracorporeallyparamagneticallycommensurabilitymicrogametophytehypersexualities
...View all with 16 letters...
Phrases (818)
tympanic membranein a beastly manneritalian greyhoundstrictly speakingfamily cyperaceaechristian huygensfamily cyprinidaedefinite quantitywilliam wycherleycardiac glycoside
...View all with 16 letters...
Words (194)
unconventionalitybacteriologicallyparathyroidectomymaterialisticallycardiorespiratoryelectrostaticallycontemporaneouslythermodynamicallyinconsequentiallysocioeconomicallypsychotherapeuticinterdisciplinaryantirevolutionaryhyperreactivitiesself-contradictoryisoelectronicallyphysiotherapeuticcercidiphyllaceaepolymorphonuclearunexchangeabilityparaformaldehydeskaleidoscopicallyhyperstimulationsspectroscopicallyhyperventilationsnonprofessionallysphygmomanometershypnotizabilitiesthrombocytopeniaschlortetracyclinemonosyllabicitiespaternalisticallymammothermographypathophysiologieshyposensitization
...View all with 17 letters...
Phrases (804)
dame margot fonteynmary leontyne pricesalvia leucophyllabalaena mysticetusczech monetary unitmary mcleod bethunehypoglycemic agentcuban monetary unitinterstate highwaypearly everlasting
...View all with 17 letters...
Words (98)
characteristicallydisproportionatelyinconsequentialityhypercoagulabilityhyperaldosteronisminterchangeabilityneuropsychologicalpolyesterificationhypersensitizationpolymorphonuclearselectrodynamometerspectroheliographypsychotherapeuticssphygmomanometrieshyposensitizationspentylenetetrazolsanthropocentricitycylindrical-stemmedlipopolysaccharidelymphangiographieshyperbilirubinemiastereospecificallyimmunocytochemicalcalymmatobacteriumstoichiometricallypteridospermaphytadiethylmalonylurearecrystallizationsmucopolysaccharidehypercholesteremiasaccharomycetaceaemagnetostrictivelymyeloproliferativephenomenologicallyhydroflumethiazide
...View all with 18 letters...
Phrases (753)
bombycilla cedrorunrevolutionary groupadministrative bodyfamily physeteridaedame sybil thorndikeeriobotrya japonicalachrymal secretionfreudian psychologygenus styracosaurusposterior pituitary
...View all with 18 letters...
Words (70)
hyperparathyroidismhydrochlorothiazidecinematographicallypolyesterificationshypersensitizationsextralinguisticallyextraterritorialityparathyroidectomieshypolipoproteinemiaparthenogeneticallynonrelativisticallymucopolysaccharideslipopolysaccharidescytodifferentiationconceptualisticallycytopathogenicitiesbacteriochlorophyllmagnetohydrodynamicphenomenalisticallyphenylthiocarbamideechoencephalographydehydrochlorinatingdehydrochlorinationphosphatidylcholinemercury-contaminatedelectrodynamometersphosphoenolpyruvateinterdepartmentallyelectromagneticallycontradistinctivelyelectromechanicallythird-dimensionalityinterferometricallyhysterosalpingogramthree-dimensionality
...View all with 19 letters...
Phrases (623)
water-plantain familyacetylsalicylic acidfamily cyclopteridaefamily cynoglossidaeseventeen-year locustitalian monetary unithydrastis canadensislatvian monetary unitalpine type of glaciergiles lytton strachey
...View all with 19 letters...
Words (40)
counterrevolutionaryuncharacteristicallyhypercholesterolemiaoverenthusiasticallytetrahydrocannabinolradioimmunoassayableparathyroidectomizedhyperadrenocorticismcytodifferentiationslymphogranulomatosesimmunocytochemicallymagnetofluiddynamicsbacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesphosphoenolpyruvatesneurophysiologicallyneuropsychiatricallyhyperlipoproteinemiamagnetohydrodynamicselectrophysiologicalmicrocrystallinitiesroentgenographicallyencephalomyocarditischemotherapeuticallypseudoparenchymatoushydrochlorothiazidespsychopharmacologiesmicrophotometricallysyncategorematicallyhypercoagulabilities
...View all with 20 letters...
Phrases (529)
william stanley jevonshonduran monetary unityellow-shafted flickerwyethia amplexicaulisorder mycelia steriliafamily phytolaccaceaemalawian monetary unitlebanese monetary unitorder myxobacterialesbalaenoptera physalus
...View all with 20 letters...
Words (14)
hypogammaglobulinemiastereomicroscopicallyalkylbenzenesulfonateacetylcholinesterasesphosphoglyceraldehydeotorhinolaryngologieselectromyographicallydendrochronologicallypolyvinyl-formaldehydeintersubstitutabilityantiferromagneticallyhypercholesterolemiaspsychotherapeuticallytetrahydrocannabinolsPhrases (356)
icelandic monetary unitaleksandr solzhenitsynmalaysian monetary unithelichrysum bracteatumbulgarian monetary unitdesoxyribonucleic acidhungarian monetary unitsri lankan monetary unitextrauterine pregnancybyzantine architecture
...View all with 21 letters...
Words (9)
pentamethylenetetrazolspectrophotometricallyelectroencephalographyphosphoglyceraldehydescarboxymethylcelluloseelectrophysiologicallyhexamethylenetetramineencephalomyocarditisesdihydroxyphenylalaninePhrases (293)
venezuelan monetary unithaliaeetus leucorhyphusredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynaccessory before the factfamily dendrocolaptidaemultiple mononeuropathyloyalist volunteer force
...View all with 22 letters...
Words (4)
carboxymethylcellulosespolytetrafluoroethylenehexamethylenetetramineshypobetalipoproteinemiaPhrases (211)
family threskiornithidaegeorge macaulay trevelyanposterior pituitary glandyellowstone national parkkazakhstani monetary unitcalycanthus occidentalisparis-sorbonne universityeuropean recovery programkyrgyzstani monetary unitbangladeshi monetary unit
...View all with 23 letters...
Words (6)
laryngotracheobronchitishyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolaminemicroelectrophoreticallyschizosaccharomycetaceaePhrases (154)
carnegie mellon universitylouis seymour bazett leakeyargyroxiphium sandwicensesubdivision deuteromycotadivision heterokontophytasubphylum cephalochordatamary wollstonecraft godwinprivately held corporationprimary sex characteristicsir terence mervyn rattigan
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (117)
embryonal rhabdomyosarcomamyroxylon balsamum pereiraemary wollstonecraft shelleydiamond wedding anniversaryfrancis scott key fitzgeraldcentral intelligence agencypolystichum acrostichoidesmelanerpes erythrocephalusbeggar-my-neighbour strategycaulophyllum thalictroides
...View all with 25 letters...
Phrases (86)
brassica oleracea gongylodeshunting and gathering societyhuman immunodeficiency virussecretary of veterans affairsemployee stock ownership planevelyn arthur saint john waughassyrian neo-aramaic languagecharles maurice de talleyrandrevolutionary calendar monthsubdivision coniferophytina
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (70)
business environment analysisamerican revolutionary leadernikita sergeyevich khrushchevholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinorder of our lady of mount carmelaugustus welby northmore puginco-operative republic of guyanacommissioned military officer
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (54)
revolutionary people's strugglealeksandr feodorovich kerenskyephippiorhynchus senegalensisoxytetracycline hydrochloridemarcus junius brutus the youngerfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationmicrosoft disk operating systemfeodor mikhailovich dostoevsky
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (38)
business environmental analysisaleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitscrutin uninominal voting systemedward george earle bulwer-lyttoninternational olympic committee
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (32)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligencedepository financial institutionethylenediaminetetraacetic acidbalance of international payments
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (21)
great smoky mountains national parkfreedom from involuntary servitudedigital communications technology2019-ncov acute respiratory diseasetupac amaru revolutionary movementrevolutionary proletarian nucleusdiego rodriguez de silva y velazquezport-access coronary bypass surgeryprimary subtractive color for lightrecombinant deoxyribonucleic acid
...View all with 31 letters...
Phrases (25)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory druguniversity of california at berkeley
...View all with 32 letters...
Phrases (17)
autonomous sensory meridian responselycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human serviceshighly active antiretroviral therapy
...View all with 33 letters...
Phrases (12)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesdryopithecus rudapithecus hungaricusmassachusetts institute of technologyerasable programmable read-only memoryeinstein's general theory of relativityeinstein's special theory of relativitygymnosporangium juniperi-virginianae
...View all with 34 letters...
Phrases (11)
communications security establishmentrevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence serviceimmaculate conception of the virgin maryhereditary motor and sensory neuropathynational socialist german workers' partydepartment of defense laboratory systemfraxinus pennsylvanica subintegerrima
...View all with 35 letters...
Phrases (10)
jakob ludwig felix mendelssohn-bartholdysecretary of state for the home departmentangiotensin-converting enzyme inhibitorchurch of jesus christ of latter-day saintsnational geospatial-intelligence agencyjuan carlos victor maria de borbon y borbonfield-sequential color television systemtransportation security administrationsecretary of health education and welfaresocialist people's libyan arab jamahiriyaPhrases (14)
severe combined immunodeficiency diseasefirst epistle of paul the apostle to timothyuniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and scienceskarl friedrich hieronymus von munchhausen
...View all with 37 letters...
