Words Containing: E,T,E,A,R
(In Any Order)
There are 14,500 words,
11,218 phrases and
0 abbr's with
E,T,E,A,R in.
Best Scoring Words With: E,T,E,A,R
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
trapeze | 7 | 18 | nounn | |||||
noun • a swing used by circus acrobats | ||||||||
excreta | 7 | 16 | nounn | |||||
noun • waste matter (as urine or sweat but especially feces) discharged from the body | ||||||||
extrema | 7 | 16 | nounn | |||||
noun • the point located farthest from the middle of something • the most extreme possible amount or value | ||||||||
exacter | 7 | 16 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
retaxed | 7 | 15 | ||||||
Valid word for Scrabble US
| ||||||||
exalter | 7 | 14 | nounn | |||||
Valid word for Scrabble US
| ||||||||
retaxes | 7 | 14 | verbv | |||||
Valid word for Scrabble US
| ||||||||
hektare | 7 | 14 | nounn | |||||
Valid word for Scrabble US
| ||||||||
weather | 7 | 13 | adverb, nounadv, n | |||||
noun • the atmospheric conditions that comprise the state of the atmosphere in terms of temperature and wind and clouds and precipitation adjective satellite • towards the side exposed to wind verb • face and withstand with courage • cause to slope • sail to the windward of • change under the action or influence of the weather | ||||||||
heather | 7 | 13 | nounn | |||||
noun • common Old World heath represented by many varieties; low evergreen grown widely in the Northern Hemisphere • interwoven yarns of mixed colors producing muted greyish shades with flecks of color | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (246)
teacherbreathecreatedweathertreatedtheaterrelatedgreatereternaltheatreheatherleathereasternretreatoperatesweaterdearestnearestfeaturefeatherheartedterracetheresaalteredveterancheatertraineeearnestcatererwateredtrapezecremateelectrasteamerberetta
...View all with 7 letters...
Phrases (12)
red meatherb teatea rosered heatbeer matash treebay treered tapepea treebe after
...View all with 7 letters...
Words (707)
whatevergreatestsergeanttreasureseparatecreatureelevatorentrancecreativerelativegatheredthreatentoleratetraveledteenagerbraceletfeathersrelevantrepeatedexternaltelegramearliestheritagedecoratebeatricedepartedgenerateliberatetravelercrematedmasteredrecreatetakeoverovertakebattered
...View all with 8 letters...
Phrases (49)
water henouter earset afirecoat treeakee treetea breaktea makergreat toebean treered alert
...View all with 8 letters...
Words (1421)
yesterdaycelebratecigarettetreatmentsecretaryagreementdesperateguaranteeadventureseparatedcatherinepermanentcooperatebatteriesentertaindeparturebartenderheartbeatshatteredscatteredgeneratorrepeatingcarpentertravelledheartlesselaboratecafeteriagreatnessdecoratedliberatedcaretakertolerancealternateprematureoperative
...View all with 9 letters...
Phrases (158)
great sealrelated toair letterin earnestpecan treeapple treecedar treebret hartetear sheettrue cedar
...View all with 9 letters...
Words (1988)
appreciatesweetheartdepartmentgenerationatmospherethreatenedunderneathresistanceliteratureelectricalearthquakewhatsoevervegetarianunderwaterguaranteedaltogetherelementarymanchesterexaggerateheadmastercelebratedirrelevantrelativelyrevelationapprenticepercentagerepeatedlyseparatelystepfatherwatermelonfederationilliteratedeliberateterminateddegenerate
...View all with 10 letters...
Phrases (263)
cover plateedgar guestprivate eyefoster carehoney eatergoat herderdragon treerewrite manbear marketpress agent
...View all with 10 letters...
Words (2309)
concentratetemperaturethreateningtransferredcelebratingcertificatecelebrationalternativesupermarketarrangementreservationreplacementwhereaboutsdemonstratedesperatelyrespectablemasterpieceappreciatedinheritancepermanentlypredictableexaggerateddesperationeverlastinginterrogateconsideratecooperativeheartbrokentreacherouselectricianperpetratortheoreticalexterminateentertainedcredentials
...View all with 11 letters...
Phrases (463)
pole vaultergreat revoltbitter aloesweather sidemeat grinderflower petalbean counterbitter pecanweather vaneprivate line
...View all with 11 letters...
Words (2174)
headquarterspresentationrefrigeratorkindergartenpresidentialentertainingarchitecturedeliberatelyconservativeexaggeratingexperimentalconcentratedchemotherapydemonstratedinterrogatedheterosexualfrankensteinveterinarianpenitentiarytroublemakertransvestitepreservationdisagreementacceleratingheadmistressimpenetrableincarceratedexaggerationpremeditatedexterminatedaccelerationgovernmentalrecreationalbacheloretteregeneration
...View all with 12 letters...
Phrases (657)
hard-to-pleasetrouble makerel libertadorhelen traubeljan tinbergenrate of returnrobert gravestenant farmerjacques ibertdrag one's feet
...View all with 12 letters...
Words (1760)
entertainmentunderestimateenvironmentalembarrassmentdeterminationunpredictablemediterraneanunforgettabletheoreticallyencouragementadvertisementschoolteacherexterminationinconsiderateheartbreakingdifferentiatedeterioratingquestionnairedeteriorationinadvertentlycharacterizedrehabilitateddisintegratedtemperamentalmagnetosphereassertivenessrefrigerationcounteractiveoverestimatedquartermasterundergraduatecontraceptivecommemorativeconfederationteleportation
...View all with 13 letters...
Phrases (781)
telegraph posttrade stoppageauditory senseblood relativegrass parakeetfull treatmentslide fastenerbreathing timelouis the greatgarbage carter
...View all with 13 letters...
Words (1461)
representativerecommendationinterpretationunderstandablerepresentationslaughterhouseunderstatementwholeheartedlyelectronicallyapprenticeshipantidepressantcontemporariesrespectabilityextraordinaireunpremeditatedmeteorologicalinterplanetaryaforementionedundersecretarytranscendentalelectroplatingmountaineeringpancreatectomycholinesteraseelectrotherapyattractivenessinternationalehyperventilatescatterbrainedconservativelycounterbalancecountermeasuregeneralizationpredestinationdifferentiated
...View all with 14 letters...
Phrases (886)
imperative formimperative moodimperative verbweather outlookgelatin dessertcircuit breakerprivate citizenjacques cartierarterial plaquegenus sarcoptes
...View all with 14 letters...
Words (1121)
electromagneticrevolutionariescinematographerexperimentationenvironmentallyentrepreneurialinterchangeableintercollegiatespermatogenesisdifferentiationheterosexualityparthenogenesisdifferentiatingparentheticallyplenipotentiaryappropriatenessgastroenteritisneoconservativemaneuverabilitytherapeuticallyenfranchisementnonexperimentalcounterargumentpostoperativelyreapportionmentrecertificationundemonstrativereinvestigatingrematerializingdemonstrativelyadventurousnessdematerializingreconcentrationelectrificationcatheterization
...View all with 15 letters...
Phrases (1011)
teutoburger waldcentaurea cyanuscharlotte brontebitter chocolateoutside marriagealimentary pastecapital of greecealectoris graecatarzan of the apesdefinite article
...View all with 15 letters...
Words (494)
extraterrestrialintercontinentalenvironmentalistelectromagnetismneurotransmitterundersecretariesenvironmentalismcountersignaturetriphenylmethanerepresentationalcounterespionagehyperventilationchemotherapeuticreinterpretationelectromagneticselectromyographysphygmomanometerdemineralizationovercompensationinterpretationalextemporaneouslyinterventriculararteriosclerosisoverenthusiasticpredeterminationcompartmentalizelightheartednessunattractivenessgastroesophagealundifferentiateddecentralizationunderachievementexteriorizationsthermolabilitiesexternalisations
...View all with 16 letters...
Phrases (992)
tympanic membranecommedia dell'artedame kiri te kanawain a beastly mannercartridge ejectorgenus crassostreaedgar albert guestperfective aspectgenus angiopterisprivate detective
...View all with 16 letters...
Words (327)
depersonalizationmisinterpretationintergovernmentaltranscendentalismmisrepresentationelectrocardiogramcompartmentalizedelectrostaticallycontemporaneouslytranscendentalistcompartmentalisedinappropriatenesspsychotherapeuticelectromechanicaldextroamphetamineuncomfortablenessinterrelationshipdematerializationinterdepartmentalhyperreactivitiescountersignaturesinextricabilitiescounterstatementsisoelectronicallyphysiotherapeuticspectroheliogramscomfortablenessesspectroheliographcounterstrategiescounterstrategistinformativenessesparameterizationsprivate-enterprisekindheartednessesextraterrestrials
...View all with 17 letters...
Phrases (1016)
weather forecasterdame margot fonteynmary leontyne pricecompetence hearingdirect correlationpontederia cordatagenus ceratosauruscivil rights leaderclomiphene citrateczech monetary unit
...View all with 17 letters...
Words (188)
gastroenterologisthyperaldosteronismdisenfranchisementoverrepresentationinterchangeabilitypolyesterificationexterritorialitieshypersensitizationcommensurabilitiesspectroheliographselectrodynamometercounterstrategistsmisinterpretationsspectroheliographythermoplasticitiesmisrepresentationsradiosensitivitiesunpredictabilitiesfaintheartednessesrambunctiousnesseslargeheartednessesunprofitablenessesarteriolosclerosisappreciativenessespsychotherapeuticsdisintermediationssphygmomanometriesarchaeoastronomieslepidopterologicalunrestrainednessespentachlorophenolspentylenetetrazolsnonrepresentativesrechromatographiescylindrical-stemmed
...View all with 18 letters...
Phrases (917)
arteria vertebralisamerican revolutionphotographer's modelfamily physeteridaeanamnestic reactiondame sybil thorndikebackspace characterlachrymal secretiondivision eubacteriaimperfective aspect
...View all with 18 letters...
Words (127)
countertransferencesternocleidomastoidpseudohermaphroditepolyesterificationsdisenfranchisementshypersensitizationscountersurveillanceextraordinarinessesextraterritorialityparathyroidectomiessurface-assimilativehypolipoproteinemiaparthenogeneticallycomplementarinessesreconceptualizationdisrespectabilitiesstereophotographiesresorcinolphthaleincounterdemonstratorcytodifferentiationauthoritativenessesgastroenterologicalgastroenterologistsgedankenexperimentsinteravailabilitiesphenylthiocarbamideprefigurativenessesreinstitutionalizedelectrocardiographsreinstitutionalizeselectrocorticogramsmercury-contaminatedneurofibromatosiseselectrodesiccationstridimensionalities
...View all with 19 letters...
Phrases (759)
measuring instrumentfavourable receptionfamily cyclopteridaesierra madre orientalrejoicing over the lawseventeen-year locusttheodore harold whitecollective agreementturbo-propeller planealpine type of glacier
...View all with 19 letters...
Words (61)
counterrevolutionaryhypercholesterolemiaoverenthusiasticallyelectroencephalogramspectroheliographieskeratoconjunctivitescountersurveillancesspectrophotometricalparathyroidectomizedcountertransferencesabetalipoproteinemiaunrepresentativenessunsatisfactorinessesreconceptualizationshyperadrenocorticismcounterdemonstrationcytodifferentiationsphenylthiocarbamidesinterchangeabilitiesacetylcholinesterasepseudohermaphroditicadrenocorticosteroidphosphoenolpyruvatesrepresentationalismsrepresentationalistsphosphomonoesteraseshyperlipoproteinemiarepresentativenesseselectrooculographiesdestructive-metabolicelectrophotographiesinappreciativenesseselectrophysiologicalanthropocentricitiesdepartmentalizations
...View all with 20 letters...
Phrases (666)
sweet-scented geraniumallium cepa aggregatumpelecanus onocrotalusgilbert charles stuartyellow-shafted flickerappendicular skeletonorder mycelia steriliaprofessional relationpast progressive tenselebanese monetary unit
...View all with 20 letters...
Words (26)
electroencephalographdisestablishmentarianextraterritorialitiesstereomicroscopicallyconstructive-metabolicstraightforwardnessesestablishmentarianisminterchangeablenesseselectrocardiographiesacetylcholinesterasespseudohermaphroditismelectroencephalogramscontemporaneousnessesadrenocorticosteroidselectromyographicallyovercommercializationelectroretinographiespseudocholinesterasescountercountermeasurecounterdemonstrationsoverintellectualizingantiferromagneticallyundemonstrativenesseshypercholesterolemiaspsychotherapeuticallycounterinterpretationPhrases (545)
acrocentric chromosomesir john everett millaissierra madre occidentaladministrative hearingelimination tournamentsierra nevada mountainsfrances hodgson burnettexperimental conditioncercopithecus aethiopsgasterosteus pungitius
...View all with 21 letters...
Words (18)
counterrevolutionarieskeratoconjunctivitidespentamethylenetetrazolkeratoconjunctivitisesdisestablishmentariansspectrophotometricallyunrepresentativenessesnonrepresentationalismelectroencephalographselectroencephalographycarboxymethylcelluloseovercommercializationselectrophysiologicallyhexamethylenetetramineencephalomyocarditisescountercountermeasuresestablishmentarianismscounterinterpretationsPhrases (446)
venezuelan monetary unitgregorian calendar monthprunus persica nectarinahaliaeetus leucorhyphustransient global amnesiaschlumbergera truncatusposterior nasal apertureredevelopment authorityhydrated aluminium oxidetrazodone hydrochloride
...View all with 22 letters...
Words (10)
electroencephalographicnonrepresentationalismselectroencephalographercarboxymethylcellulosespolytetrafluoroethylenehexamethylenetetraminesintersubstitutabilitiesoverintellectualizationdichlorodifluoromethanehypobetalipoproteinemiaPhrases (290)
gilbert and ellice islandsfamily threskiornithidaeparenthetical expressiontransient ischemic attackgeorge macaulay trevelyanchlorpheniramine maleateto all intents and purposesboeing b-52 stratofortressyellowstone national parkelectromechanical device
...View all with 23 letters...
Words (8)
hyperbetalipoproteinemiaelectrocardiographicallyelectroencephalographerselectroencephalographiesmicroelectrophoreticallyoverintellectualizationsdichlorodifluoromethanesschizosaccharomycetaceaePhrases (260)
carnegie mellon universitylouis seymour bazett leakeylowland burrowing treefrogsubdivision deuteromycotadivision heterokontophytaprivately held corporationtrip the light fantastic toecapture of fort ticonderogaprimary sex characteristicbattle of the little bighorn
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyantiestablishmentarianismPhrases (232)
count ferdinand von zeppelinunited states secret servicecluster of differentiation 4balaenoptera acutorostratabureau of justice assistancebureau of justice statisticsmary wollstonecraft shelleymiguel de cervantes saavedrafrancis scott key fitzgeraldcruel and unusual punishment
...View all with 25 letters...
Phrases (154)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanbattle of monmouth court housefrances eliza hodgson burnettx-linked dominant inheritanceconfederate states of americaright atrioventricular valvebattle of the teutoburg forestpolicing and enforcement costalternanthera philoxeroides
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (97)
business environment analysispartial differential equationamerican revolutionary leadernikita sergeyevich khrushchevorder of our lady of mount carmelelectromechanical transducersolenostemon scutellarioidesaugustus welby northmore pugindirector-stockholder relationco-operative republic of guyana
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (104)
revolutionary people's strugglecoccothraustes coccothraustesinterstate commerce commissionbureau of engraving and printingoxytetracycline hydrochloridemarcus junius brutus the youngermicrosoft disk operating systembattles of lexington and concordcapital of serbia and montenegrodemocratic republic of the congo
...View all with 28 letters...
Phrases (84)
business environmental analysisbusiness interruption insurancechemical decomposition reactionacrylonitrile-butadiene-styreneantisocial personality disordermale internal reproductive organfriedrich wilhelm august froebelnational volunteers associationdisorganized type schizophreniaautomatic data processing system
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (58)
battle of spotsylvania court housebattle of spotsylvania courthousevalentina vladmirovna tereshkovamusculus sternocleidomastoideusalexander isayevich solzhenitsynglutamic oxalacetic transaminaseobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligence
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (54)
united states public health servicebureau of intelligence and researchfreedom from involuntary servitudemarie louise elisabeth vigee-lebrun2019-ncov acute respiratory diseasepetroselinum crispum neapolitanumguiseppe fortunino francesco verdiunited states department of defensetupac amaru revolutionary movementsidonie-gabrielle claudine colette
...View all with 31 letters...
Words (1)
tetrabromo-phenolsulfonephthaleinPhrases (36)
people against gangsterism and drugspatent and trademark office databasedepartment of the federal governmenthierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyintercontinental ballistic missilestraight-line method of depreciationrevolutionary justice organizationobject-oriented programing language
...View all with 32 letters...
Phrases (36)
characteristic root of a square matrixlinear-quadratic-gaussian controllermusical instrument digital interfaceautonomous sensory meridian responsebreach of trust with fraudulent intentinternational maritime organizationstandard generalized markup languagelycopersicon esculentum cerasiformeobject-oriented programming languagebureau of alcohol tobacco and firearms
...View all with 33 letters...
Phrases (33)
jacques francois fromental elie halevyrelational database management systemconfidential adviser-advisee relationchronic obstructive pulmonary diseasefederal islamic republic of the comorosfederal national mortgage associationacademy of television arts and sciencesepistle of paul the apostle to the romansinterstitial cell-stimulating hormonemusculus sphincter ductus pancreatici
...View all with 34 letters...
Phrases (29)
national technical information servicejohann christoph friedrich von schillercommunications security establishmentinternational development associationunited states postal inspection servicetadeusz andrzej bonawentura kosciuszkorevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycomte donatien alphonse francois de sade
...View all with 35 letters...
Phrases (22)
center for disease control and preventionrank-difference correlation coefficientjakob ludwig felix mendelssohn-bartholdysecretary of state for the home departmentangiotensin-converting enzyme inhibitorforeign intelligence surveillance courtchurch of jesus christ of latter-day saintsfield-sequential color television systemfreedom from cruel and unusual punishmenttripleurospermum oreades tchihatchewii
...View all with 36 letters...
Phrases (20)
sisters of the order of saint basil the greatfirst epistle of paul the apostle to timothyunited states declaration of independencetheodore roosevelt memorial national parkketoacidosis-resistant diabetes mellitusuniversity of north carolina at chapel hillattention deficit hyperactivity disordercentre for international crime preventiondemocratic and popular republic of algeriagenerally accepted accounting principles
...View all with 37 letters...
Phrases (9)
general certificate of secondary educationunited states government accounting officeobject-oriented database management systemalexis charles henri maurice de tocquevilledemocratic republic of sao tome and principeeconomic commission for asia and the far eastmarie joseph paul yves roch gilbert du motierdepartment of housing and urban developmentadvanced research and development activityPhrases (12)
million floating point operations per secondbillion floating point operations per secondrussian soviet federated socialist republicdefense reutilization and marketing serviceislamic jihad for the liberation of palestinedirectorate for inter-services intelligencerespiratory distress syndrome of the newborngates of the arctic national park and preservenucleoside reverse transcriptase inhibitorpopular front for the liberation of palestine
...View all with 39 letters...
Phrases (11)
minnesota multiphasic personality inventoryrevolutionary proletarian initiative nucleinational archives and records administrationprayer of azariah and song of the three childrenlaser-assisted subepithelial keratomileusisregents of the university of california v. bakkerussian soviet federative socialist republicinternational relations and security networkursulines of mary immaculate virgin of gandinofirst of october antifascist resistance group
...View all with 40 letters...
Phrases (7)
national aeronautics and space administrationorganization of petroleum-exporting countriesnational institute of standards and technologyfirst of october anti-fascist resistance groupsoccupational safety and health administrationship-towed long-range acoustic detection system5-hydroxy-3-methylglutaryl-coenzyme a reductasePhrases (7)
national oceanic and atmospheric administrationtransmission control protocol/internet protocolcooper union for the advancement of science and artfirst amendment to the united states constitutionarmenian secret army for the liberation of armeniamedical literature analysis and retrieval systeminternational society for krishna consciousnessPhrases (6)
association for the advancement of retired personsprayer of azariah and song of the three holy childrengeorges leopold chretien frederic dagobert cuvierconte alessandro giuseppe antonio anastasio voltafirst epistle of paul the apostle to the corinthiansunited states army criminal investigation commandPhrases (6)
international bank for reconstruction and developmentfourteenth amendment to the united states constitutionfood and agriculture organization of the united nationsunited nations international children's emergency fundroyal society of london for improving natural knowledgeunited society of believers in christ's second appearing