Words Containing: E,T,E,A
(In Any Order)
There are 21,811 words,
14,247 phrases and
0 abbr's with
E,T,E,A in.
Best Scoring
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| exabyte | 7 | 19 | nounn | |||||
noun • a unit of information equal to 1000 petabytes or 10^18 bytes • a unit of information equal to 1024 pebibytes or 2^60 bytes | ||||||||
| trapeze | 7 | 18 | nounn | |||||
noun • a swing used by circus acrobats | ||||||||
| epazote | 7 | 18 | nounn | |||||
noun • A pungent herb used in Latin-American cooking and tea making, and in folk medicine; Dysphania ambrosioides. | ||||||||
| gazette | 7 | 17 | verb, nounv, n | |||||
noun • a newspaper or official journal verb • publish in a gazette | ||||||||
| equated | 7 | 17 | verbv | |||||
verb • consider or describe as similar, equal, or analogous • be equivalent or parallel, in mathematics • make equal, uniform, corresponding, or matching | ||||||||
| telefax | 7 | 17 | verb, nounv, n | |||||
verb • send something via a facsimile machine | ||||||||
| exacted | 7 | 17 | verbv | |||||
adjective • marked by strict and particular and complete accordance with fact adjective satellite • (of ideas, images, representations, expressions) characterized by perfect conformity to fact or truth; strictly correct • lacking compromising or mitigating elements verb • claim as due or just • take as an undesirable consequence of some event or state of affairs | ||||||||
| teazled | 7 | 17 | verb, adjectivev, adj | |||||
verb • To raise the nap on cloth; to tease; to card. | ||||||||
| exapted | 7 | 17 | verb, adjectivev, adj | |||||
Valid word for Scrabble US
| ||||||||
| dejecta | 7 | 17 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (539)
teacherbreathecreatedweathertreatedtheaterrelatedgreatereternaltheatrebeneathheatherleathereasternretreatoperatesweaterelegantdearestseattlenearestfeaturefeatherheartedteenageterraceathletebeatlestheresaeasiestalterededucatecanteenveterancheater
...View all with 7 letters...
Phrases (33)
beef teared meatdead setat peacedue dateal denteherb teatea leaficed teatea rose
...View all with 7 letters...
Words (1388)
whatevergreatestsergeanttreasureseparateacceptedcreaturenegativebasementelevatorentrancepatiencetalentedelephantcreativerelativegatheredmeantimedelicateeducateddefeatedappetitethreatentolerateaffectedtraveledteenagerhesitateevacuatebraceletfeathersrelevantattendeddedicaterepeated
...View all with 8 letters...
Phrases (110)
leave outheated upseed coatgem statebeta testcat's feetlove seattest caseeast sidejet plane
...View all with 8 letters...
Words (2462)
yesterdaygentlemancelebratecigarettetreatmentsecretaryagreementdesperatestatementguaranteeelizabethexhaustedsatelliteadventureseparatedcatherinedefendantpermanentimmediatecooperatededicatedessentialnegotiateattemptedbatteriesvalentineeliminatevegetableentertaindeparturebartenderheartbeattestamentshatteredscattered
...View all with 9 letters...
Phrases (264)
great sealpast tenserelated toseed plantedible fatair letterget-at-ablein earnestpecan treeapple tree
...View all with 9 letters...
Words (3104)
appreciatesweetheartdepartmentlieutenanteventuallygenerationatmospherethreatenedunderneathmanagementengagementresistanceliteratureelectricalearthquakewhatsoevervegetarianunderwaterguaranteedaltogetherinevitablelegitimateelementaryacceptablemanchesterdevastatedexaggerateheadmastercelebratedirrelevantrelativelyeliminatedrevelationequivalentapprentice
...View all with 10 letters...
Phrases (466)
tea essencecover plateedgar guestprivate eyetv audiencefoster caresales eventfacet planehoney eaternoble metal
...View all with 10 letters...
Words (3394)
immediatelyconcentratetemperaturethreateningtransferredinvestigatecelebratingcertificatecelebrationalternativeestablishedsupermarketarrangementmaintenancereservationsentimentalreplacementessentiallywhereaboutsdemonstratedesperatelyrespectablemasterpieceappreciatedbattlefieldinheritanceexceptionalachievementpermanentlypredictableexaggerateddesperationeverlastinginterrogategenetically
...View all with 11 letters...
Phrases (689)
pole vaultergreat revoltbitter aloesweather sidegenus bletiameat grindercomte de saxeflower petalbean counterbitter pecan
...View all with 11 letters...
Words (3092)
headquartersannouncementpresentationintellectualrefrigeratorkindergartenpresidentialentertainingarchitecturedeliberatelyunacceptableconservativeinvestigatedexaggeratingexperimentalconcentratedchemotherapydemonstratedaffectionateillegitimateinterrogatedheterosexualfrankensteinveterinarianpenitentiarytroublemakertransvestitequestionablepreservationdisagreementacceleratingheadmistressimpenetrableincarceratedexaggeration
...View all with 12 letters...
Phrases (929)
hard-to-pleasetrouble makerathene noctuael libertadorsecond adventgenus anethumhelen traubelold line statejan tinbergenrate of return
...View all with 12 letters...
Words (2498)
entertainmentestablishmentunderestimateenvironmentalembarrassmentdeterminationunpredictablemediterraneanunforgettabletheoreticallyencouragementadvertisementschoolteacherexceptionallyinvestigativeexterminationinconsiderateheartbreakingdifferentiatedeterioratingquestionnairedeteriorationinadvertentlycharacterizedrehabilitateddisintegratedtemperamentalmagnetosphereassertivenessauthenticatedrefrigerationcounteractiveexponentiallyoverestimatedquartermaster
...View all with 13 letters...
Phrases (1056)
telegraph postwhite asbestostrade stoppagemight-have-beenauditory senseblood relativegrass parakeetfull treatmentslide fastenerbreathing time
...View all with 13 letters...
Words (2045)
representativerecommendationinterpretationunderstandablerepresentationslaughterhouseunderstatementintellectuallywholeheartedlyimplementationaffectionatelyelectronicallyapprenticeshipantidepressantexcommunicatedcontemporariessentimentalityrespectabilityextraordinaireunpremeditatedmeteorologicalinterplanetaryaforementionedecclesiasticalunpleasantnessundersecretaryquintessentialtranscendentalelectroplatingmountaineeringpancreatectomyexistentialismunquestionableintelligentsiacholinesterase
...View all with 14 letters...
Phrases (1182)
imperative formimperative moodexpense accountimperative verbweather outlookgelatin dessertcircuit breakerprivate citizengenus blattellajacques cartier
...View all with 14 letters...
Words (1537)
electromagneticrevolutionariescinematographerexperimentationmethamphetamineacknowledgementenvironmentallyentrepreneurialinconsequentialanaesthesiologyinterchangeableintercollegiatespermatogenesisdifferentiationheterosexualityparthenogenesisdesensitizationdevelopmentallydifferentiatingintellectualismintellectualityparentheticallyplenipotentiaryappropriatenessgastroenteritisneoconservativemaneuverabilitytherapeuticallyintellectualizeenfranchisementacquisitivenessmethylphenidatenonexperimentalgentlemanlinesscounterargument
...View all with 15 letters...
Phrases (1284)
stay of executionteutoburger waldavestan languagecentaurea cyanuscharlotte brontebitter chocolateoutside marriagealimentary pastecapital of greecegenus potentilla
...View all with 15 letters...
Words (661)
extraterrestrialintercontinentalenvironmentalistanesthesiologistelectromagnetismneurotransmitterundersecretariesenvironmentalismcountersignaturetriphenylmethanerepresentationalcounterespionagehyperventilationquintessentiallychemotherapeuticphylogeneticallyreinterpretationelectromagneticselectromyographyintellectualizedsphygmomanometerdemineralizationovercompensationostentatiousnessinterpretationalextemporaneouslyinterventricularabsentmindednessarteriosclerosisoverenthusiasticpredeterminationcompartmentalizelightheartednessunattractivenessgastroesophageal
...View all with 16 letters...
Phrases (1271)
tympanic membranemultiengine planecommedia dell'artemanihot esculentadame kiri te kanawain a beastly mannercartridge ejectorgenus crassostreaedgar albert guestperfective aspect
...View all with 16 letters...
Words (404)
depersonalizationtelecommunicationmisinterpretationintergovernmentaltranscendentalismmisrepresentationelectrocardiogramcompartmentalizedintellectualizingelectrostaticallycontemporaneouslyinconsequentiallytranscendentalistcompartmentalisedinappropriatenesspsychotherapeuticelectromechanicaldextroamphetamineuncomfortablenessinterrelationshipdematerializationinterdepartmentalhyperreactivitiescountersignaturesinextricabilitiescounterstatementsisoelectronicallyphysiotherapeuticspectroheliogramsunexchangeabilitycomfortablenessesspectroheliographcounterstrategiescounterstrategistunmitigatednesses
...View all with 17 letters...
Phrases (1270)
weather forecasterdame margot fonteynmary leontyne pricecompetence hearingdirect correlationpontederia cordatagenus ceratosaurusbalaena mysticetuscivil rights leaderclomiphene citrate
...View all with 17 letters...
Words (230)
telecommunicationsinconsequentialitygastroenterologisthyperaldosteronismdisenfranchisementoverrepresentationinterchangeabilitypolyesterificationexterritorialitieshypersensitizationcommensurabilitiesspectroheliographselectrodynamometercounterstrategistsmisinterpretationsspectroheliographythermoplasticitiesknowledgeabilitiesmisrepresentationsradiosensitivitiesunpredictabilitiesinhospitablenessesfaintheartednessesrambunctiousnesseslargeheartednessesunprofitablenessesarteriolosclerosisappreciativenessespsychotherapeuticsdisintermediationssphygmomanometriesarchaeoastronomieslepidopterologicalunrestrainednessescolumbite-tantalite
...View all with 18 letters...
Phrases (1102)
arteria vertebralisoceanites oceanicusamerican revolutionisabella i of castilephotographer's modelfamily physeteridaeanamnestic reactiondame sybil thorndikebackspace characterlachrymal secretion
...View all with 18 letters...
Words (158)
countertransferencesternocleidomastoidpseudohermaphroditeintellectualizationpolyesterificationsdisenfranchisementshypersensitizationscountersurveillanceextraordinarinessesextraterritorialityparathyroidectomiessurface-assimilativecommunicativenesseshypolipoproteinemiaparthenogeneticallydispassionatenessescompassionatenessesinstantaneousnessesencephalomeningitiscomplementarinessesreconceptualizationdisrespectabilitiesstereophotographiesresorcinolphthaleincounterdemonstratorcytodifferentiationauthoritativenessescytopathogenicitiesobjectionablenessesphenomenalisticallyconsequentialnessesgastroenterologicalgastroenterologistsgedankenexperimentsinteravailabilities
...View all with 19 letters...
Phrases (921)
measuring instrumentfavourable receptionfamily cyclopteridaesierra madre orientalrejoicing over the lawseventeen-year locusttheodore harold whitecollective agreementturbo-propeller planealpine type of glacier
...View all with 19 letters...
Words (65)
counterrevolutionaryhypercholesterolemiaoverenthusiasticallyelectroencephalogramspectroheliographieskeratoconjunctivitescountersurveillancesspectrophotometricalparathyroidectomizedcountertransferencesabetalipoproteinemiaunrepresentativenessunsatisfactorinessesreconceptualizationshyperadrenocorticismcounterdemonstrationcytodifferentiationsintellectualizationsphenylthiocarbamidesinterchangeabilitiesacetylcholinesterasepseudohermaphroditicadrenocorticosteroidphosphoenolpyruvatesrepresentationalismsrepresentationalistsphosphomonoesteraseshyperlipoproteinemiarepresentativenesseselectrooculographiesdestructive-metabolicelectrophotographiesinappreciativenesseselectrophysiologicalanthropocentricities
...View all with 20 letters...
Phrases (772)
william stanley jevonssweet-scented geraniumallium cepa aggregatumpelecanus onocrotalusgilbert charles stuartyellow-shafted flickerappendicular skeletonwyethia amplexicaulisorder mycelia steriliaprofessional relation
...View all with 20 letters...
Words (32)
electroencephalographdisestablishmentarianextraterritorialitiesstereomicroscopicallymultidimensionalitiesconstructive-metabolicstraightforwardnessesestablishmentarianismalkylbenzenesulfonateinterchangeablenesseselectrocardiographiesacetylcholinesterasespseudohermaphroditismelectroencephalogramscontemporaneousnessesadrenocorticosteroidsmeningoencephalitideselectromyographicallyovercommercializationelectroretinographiespseudocholinesterasescountercountermeasurecounterdemonstrationsoverintellectualizingantiferromagneticallyundemonstrativenesseshypercholesterolemiasindistinguishablenesspsychotherapeuticallycounterinterpretationunexceptionablenessesdisadvantageousnessesPhrases (638)
acrocentric chromosomesir john everett millaisagglutinative languagesierra madre occidentalabelmoschus esculentusadministrative hearingelimination tournamentsierra nevada mountainsfrances hodgson burnettexperimental condition
...View all with 21 letters...
Words (18)
counterrevolutionarieskeratoconjunctivitidespentamethylenetetrazolkeratoconjunctivitisesdisestablishmentariansspectrophotometricallyunrepresentativenessesnonrepresentationalismelectroencephalographselectroencephalographycarboxymethylcelluloseovercommercializationselectrophysiologicallyhexamethylenetetramineencephalomyocarditisescountercountermeasuresestablishmentarianismscounterinterpretationsPhrases (498)
venezuelan monetary unitgregorian calendar monthprunus persica nectarinahaliaeetus leucorhyphustransient global amnesiaschlumbergera truncatusposterior nasal apertureredevelopment authorityhydrated aluminium oxidetrazodone hydrochloride
...View all with 22 letters...
Words (11)
electroencephalographicnonrepresentationalismselectroencephalographercarboxymethylcellulosespolytetrafluoroethylenehexamethylenetetraminesintersubstitutabilitiesoverintellectualizationdichlorodifluoromethaneindistinguishablenesseshypobetalipoproteinemiaPhrases (327)
gilbert and ellice islandsfamily threskiornithidaeparenthetical expressiontransient ischemic attacksecond battle of el alameingeorge macaulay trevelyanchlorpheniramine maleateto all intents and purposessubpoena ad testificandumboeing b-52 stratofortress
...View all with 23 letters...
Words (9)
hyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolamineelectroencephalographerselectroencephalographiesmicroelectrophoreticallyoverintellectualizationsdichlorodifluoromethanesschizosaccharomycetaceaePhrases (290)
carnegie mellon universitylouis seymour bazett leakeylowland burrowing treefrogsubdivision deuteromycotadivision heterokontophytaprivately held corporationtrip the light fantastic toecapture of fort ticonderogaprimary sex characteristicbattle of the little bighorn
...View all with 24 letters...
Words (3)
immunoelectrophoreticallyphosphatidylethanolaminesantiestablishmentarianismPhrases (249)
count ferdinand von zeppelinunited states secret servicecluster of differentiation 4balaenoptera acutorostratabureau of justice assistancebureau of justice statisticsmary wollstonecraft shelleymiguel de cervantes saavedrafrancis scott key fitzgeraldbattle of the chemin-des-dames
...View all with 25 letters...
Phrases (176)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanbattle of monmouth court housefrances eliza hodgson burnettx-linked dominant inheritanceconfederate states of americabacon-lettuce-tomato sandwichnational institutes of healthright atrioventricular valvebattle of the teutoburg forest
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (107)
business environment analysispartial differential equationamerican revolutionary leadernikita sergeyevich khrushchevorder of our lady of mount carmelelectromechanical transduceroffice of management and budgetsolenostemon scutellarioidesaugustus welby northmore pugindirector-stockholder relation
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (114)
revolutionary people's strugglecoccothraustes coccothraustesinterstate commerce commissionbureau of engraving and printingoxytetracycline hydrochloridemarcus junius brutus the youngermicrosoft disk operating systemcommission on the status of womenbattles of lexington and concordcapital of serbia and montenegro
...View all with 28 letters...
Words (2)
methylenedioxymethamphetaminehexakosioihexekontahexaphobiaPhrases (90)
business environmental analysisbusiness interruption insurancesecond council of constantinoplechemical decomposition reactionacrylonitrile-butadiene-styreneantisocial personality disordermale internal reproductive organfriedrich wilhelm august froebelnational volunteers associationdisorganized type schizophrenia
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (63)
battle of spotsylvania court housebattle of spotsylvania courthousevalentina vladmirovna tereshkovamusculus sternocleidomastoideusalexander isayevich solzhenitsynglutamic oxalacetic transaminaseobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligence
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (59)
united states public health servicebureau of intelligence and researchsecond epistle to the thessaloniansfreedom from involuntary servitudemarie louise elisabeth vigee-lebrun2019-ncov acute respiratory diseasepetroselinum crispum neapolitanumguiseppe fortunino francesco verdiunited states department of defensetupac amaru revolutionary movement
...View all with 31 letters...
Words (1)
tetrabromo-phenolsulfonephthaleinPhrases (39)
people against gangsterism and drugspatent and trademark office databasedepartment of the federal governmenthierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyintercontinental ballistic missilestraight-line method of depreciationrevolutionary justice organizationobject-oriented programing language
...View all with 32 letters...
Phrases (40)
characteristic root of a square matrixlinear-quadratic-gaussian controllermusical instrument digital interfaceautonomous sensory meridian responsebreach of trust with fraudulent intentinternational maritime organizationstandard generalized markup languageepistle of paul the apostle to philemonlycopersicon esculentum cerasiformeobject-oriented programming language
...View all with 33 letters...
Phrases (34)
jacques francois fromental elie halevyrelational database management systemconfidential adviser-advisee relationchronic obstructive pulmonary diseasefederal islamic republic of the comorosfederal national mortgage associationacademy of television arts and sciencesepistle of paul the apostle to the romansinterstitial cell-stimulating hormonemusculus sphincter ductus pancreatici
...View all with 34 letters...
Phrases (31)
national baseball hall of fame and museumnational technical information servicejohann christoph friedrich von schillercommunications security establishmentinternational development associationunited states postal inspection servicetadeusz andrzej bonawentura kosciuszkorevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation party
...View all with 35 letters...
Phrases (23)
center for disease control and preventionrank-difference correlation coefficientjakob ludwig felix mendelssohn-bartholdysecretary of state for the home departmentangiotensin-converting enzyme inhibitorforeign intelligence surveillance courtchurch of jesus christ of latter-day saintsnational geospatial-intelligence agencyfield-sequential color television systemfreedom from cruel and unusual punishment
...View all with 36 letters...
Phrases (22)
sisters of the order of saint basil the greatfirst epistle of paul the apostle to timothyunited states declaration of independencetheodore roosevelt memorial national parkketoacidosis-resistant diabetes mellitusuniversity of north carolina at chapel hillattention deficit hyperactivity disordercentre for international crime preventiondemocratic and popular republic of algeriagenerally accepted accounting principles
...View all with 37 letters...
Phrases (11)
general certificate of secondary educationunited states government accounting officeobject-oriented database management systemsecond epistle of paul the apostle to timothyalexis charles henri maurice de tocquevilledemocratic republic of sao tome and principeeconomic commission for asia and the far eastmarie joseph paul yves roch gilbert du motierdepartment of housing and urban developmentadvanced research and development activity
...View all with 38 letters...
Phrases (13)
million floating point operations per secondbillion floating point operations per secondrussian soviet federated socialist republicdefense reutilization and marketing serviceislamic jihad for the liberation of palestinedirectorate for inter-services intelligencerespiratory distress syndrome of the newborngates of the arctic national park and preservenucleoside reverse transcriptase inhibitorpopular front for the liberation of palestine
...View all with 39 letters...
Phrases (12)
nicotinamide adenine dinucleotide phosphateminnesota multiphasic personality inventoryrevolutionary proletarian initiative nucleinational archives and records administrationprayer of azariah and song of the three childrenlaser-assisted subepithelial keratomileusisregents of the university of california v. bakkerussian soviet federative socialist republicinternational relations and security networkursulines of mary immaculate virgin of gandino
...View all with 40 letters...
Phrases (7)
national aeronautics and space administrationorganization of petroleum-exporting countriesnational institute of standards and technologyfirst of october anti-fascist resistance groupsoccupational safety and health administrationship-towed long-range acoustic detection system5-hydroxy-3-methylglutaryl-coenzyme a reductasePhrases (8)
national oceanic and atmospheric administrationtransmission control protocol/internet protocolcooper union for the advancement of science and artfifth amendment to the united states constitutionfirst amendment to the united states constitutionarmenian secret army for the liberation of armeniamedical literature analysis and retrieval systeminternational society for krishna consciousnessPhrases (6)
association for the advancement of retired personsprayer of azariah and song of the three holy childrengeorges leopold chretien frederic dagobert cuvierconte alessandro giuseppe antonio anastasio voltafirst epistle of paul the apostle to the corinthiansunited states army criminal investigation commandPhrases (8)
international bank for reconstruction and developmentnineteenth amendment to the united states constitutionfourteenth amendment to the united states constitutionfood and agriculture organization of the united nationseighteenth amendment to the united states constitutionunited nations international children's emergency fundroyal society of london for improving natural knowledgeunited society of believers in christ's second appearing
