Words Containing: E,S,H,E,N,S
(In Any Order)
There are 2,326 words,
1,749 phrases and
0 abbr's with
E,S,H,E,N,S in.
Best Scoring Words With: E,S,H,E,N,S
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
sphenes | 7 | 12 | nounn | |||||
Valid word for Scrabble US
| ||||||||
menshes | 7 | 12 | noun, adjectiven, adj | |||||
noun • a decent responsible person with admirable characteristics | ||||||||
sheens | 6 | 9 | nounn | |||||
noun • the visual property of something that shines with reflected light | ||||||||
sneesh | 6 | 9 | nounn | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (95)
shoeshinefreshnessharnessedwhitenesssheepskinheavinesswholenessseneschalcheapnesshenhouseshomeynessephesiansothernesslithenessheftinesshonestestharnessesevanishesenswathesshynessesinspheressightseenhipnessessheernesssheetingsnathelesschewinesssynthesesensheathshonestiesshagreensnephrosesenglishesspleenishenspheres
...View all with 9 letters...
Words (161)
anesthesiastephensonhoarsenesssynthesizehumblenesshandednesschangelesspenthousesjewishnesssynthesisesheepshanksinghalesehumanenesscheekinessshrewdnesschastenesschoicenessgauchenesshiddennesstetchinessantithesesinsheathesholinessesepenthesisshoeshineswhetstoneschanteusesposhnessesepenthesesmuchnessesstenchiestenravishesshorelinesrefreshenschasteners
...View all with 10 letters...
Phrases (8)
mt. st. helensst john's evevenus's shoetennis shoehorse sensehouse snakebench presssixth senseWords (286)
nonethelesssightseeingselfishnesssmithereenssynthesizeranaesthesiaenchantressgreenhousesanesthetistsynesthesiasynthesizedparenthesismendelssohnschlesingerhealthinesshatefulnesskinesthesiaheinousnesssightednessstonewashedhideousnesshopefulnesssynthesiserhirsutenesshurriednesshelpfulnesspettishnessweightinessheedfulnesswealthinesspeevishnesssharpnesseshypotenusesshininesseslithenesses
...View all with 11 letters...
Phrases (17)
hornet's nestspeech soundharness racefisheye lenssingle shellhornets' nestchinese shangenus tethusstern chaserenglish sole
...View all with 11 letters...
Words (381)
neverthelesshelplessnesstogethernesshopelessnesssouthwesternwestinghousesoutheasternhomesicknessanaestheticscheerfulnesswretchednessanaesthetisthomelessnessruthlessnesshorriblenesshandsomenessrhinocerosessceneshifteranaesthetiseshrewishnesschastisementcohesivenesssynaesthesiadevilishnesssheepishnessthievishnessstealthinessshamefulnessfeverishnessmotherlinessfatherlinessadhesivenessheedlessnessheavenlinessharmlessness
...View all with 12 letters...
Phrases (35)
chinese anisehunter's saucesash fastenerrhesus monkeyhebrew lessonphone messagehouse servantharness horseof the essencesense of humor
...View all with 12 letters...
Words (444)
establishmentrighteousnessshakespeareanshamelessnessthoracentesisfaithlessnessloathsomenesschangefulnessworthlessnesswholesomenesselephantiasisheartlessnessshakespearianpigheadednessunselfishnessmorphogenesissqueamishnesslecherousnesspresidentshiphonorablenesshabitablenesscheerlessnesscrotchetinessuprightnessesstylishnessesinheritresseslengthinessesphalansterieshaughtinessesdelightednessnaughtinessesdeathlessnessrestrengthensweightinessesshallownesses
...View all with 13 letters...
Phrases (78)
mount st. helensgenus gopherusgenus anthemisstephen fostercool one's heelsfounders' sharejapanese chessgenus haemopishorse chestnuthenri rousseau
...View all with 13 letters...
Words (357)
hypersensitivecholinesterasephosphorescentchemosynthesisweightlessnessbreathlessnessbullheadednessphotosensitivedisenfranchisemechanicalnesshospitablenessfarsightednessneighborlinessanesthesiologyservomechanismcoquettishnesschangelessnessnewsworthinessshamefacednessopenhandednessthriftlessnessmethodicalnesschangeablenesssnobbishnessescomprehensionsboneheadednessreestablishingdelightfulnessadhesivenesseshardheadednessdehydrogenasesnoteworthinessworthwhilenesseuphoniousnesswatertightness
...View all with 14 letters...
Phrases (86)
chanson de gestefisherman's lurefishing licensestephen spenderchinese parsleygenus hamamelisjapanese radishgenus delphinusgenus euthynnushenry kissinger
...View all with 14 letters...
Words (258)
disenfranchisedanaesthesiologymisapprehensionparthenogenesisforesightednessphotosynthesizeunrighteousnessmischievousnesslightheadednessthoughtlessnessnearsightednessunderhandednessphosphorescencekindheartednesstightfistednesssoftheartednessdownheartednessblameworthinesshypersensitizedwarmheartednesscoldheartednesshomogeneousnessreproachfulnessblasphemousnesstreacherousnessreestablishmentphotosensitizedunsightlinesseslevelheadednesschangefulnessesswellheadednessdeathlessnessesunderemphasizesfashionablenesspigheadednesses
...View all with 15 letters...
Phrases (143)
high renaissancesir john herschelgenus anthocerossnake in the grassshel silversteingenus phascogaleschool newspapergenus haematopusmerchant vesselsgenus chordeiles
...View all with 15 letters...
Words (122)
anesthesiologistshortsightednesshypersensitivityoverenthusiasticlightheartednessmiscomprehensionhypersensitizingpraiseworthinesshypersomnolencesunneighborlinessapocryphalnesseslargeheartednessthoughtfulnessesspeechlessnessesthreadbarenesseshypervitaminosesthriftlessnessesfarfetchednessesfarsightednessesposthumousnessesfathomlessnessesmotherlessnessessprightfulnessesmuddleheadednesslongheadednessesimperishablenessuntruthfulnessesforehandednessesnortheasternmostnorthwesternmoststeprelationshipnoteworthinesseswholeheartednessforthrightnessesreestablishments
...View all with 16 letters...
Phrases (154)
president johnsonhonest-to-goodnessgenus chaenomeleschristmas presentgenus cheilanthesgenus cheiranthusgenus epinephelusmechanical stressmechanical systemnorthwest passage
...View all with 16 letters...
Words (74)
comprehensivenessmiscomprehensionskindheartednessesdisestablishmentsdisfranchisementsinheritablenessesthoughtlessnessessphygmomanometerscrashworthinessesfashionablenessesunrighteousnessesarchconservativestightfistednessestenderheartednesslevelheadednessesstandoffishnessesmachine-accessiblelongsightednessesimmunochemistriesauthoritativenessforesightednessespharisaicalnessesdownheartednesseswarmheartednessesopenheartednessesnearsightednessesopenmouthednessestreacherousnesseswrongheadednessesblameworthinessestrueheartednessesblasphemousnessesreprehensiblenesstrustworthinessesneurophysiologies
...View all with 17 letters...
Phrases (182)
past-tense morphemebureau of the censusdianthus deltoidesgenus phacochoerusgenus phalaenopsisgenus acridotheressinhalese languagearthur schlesingerhenri louis bergsonhorse chestnut balm
...View all with 17 letters...
Words (50)
hyperaldosteronismdisenfranchisementhypersensitivenessmethyltestosteronehypersensitivitieshypersensitizationinharmoniousnessesinhospitablenessesdishonorablenessesfaintheartednesseslargeheartednessesapprehensivenessessphygmomanometriesarchaeoastronomiescreditworthinesseslightheartednessesmuddleheadednessescomprehensiblenesspraiseworthinessesaustralopithecinesstoutheartednessesforethoughtfulnessweatherproofnessescharacteristicnessdehydrochlorinasesmechanochemistriesimperishablenessesreprehensibilitiesotherworldlinessesgreatheartednessesbloodthirstinessesanticholinesterasephotodisintegratesheavyheartednesseschemiluminescences
...View all with 18 letters...
Phrases (162)
mount rushmore statesir matthew flindersgenus encephalartospolianthes tuberosagenus chamaecytisusgeorge westinghouseascension of the lordoscar hammerstein iiarthur m. schlesingerunfinished business
...View all with 18 letters...
Words (19)
thermoluminescencesdisenfranchisementshypersensitizationscomprehensibilitiescomprehensivenessesauthoritativenessesreprehensiblenessesphosphomonoesterasemethylprednisolonesheterogeneousnessesanticholinesterasesgood-neighbourlinessphotoreconnaissanceestablishmentariansethnomethodologistsinterchangeablenesstenderheartednessesunfashionablenessesinexhaustiblenessesPhrases (122)
giles lytton stracheyshakespearean sonnethelianthus tuberosuspounds per square inchjapanese honeysucklesecondary censorshiptrichopterous insectgenus delphinapterushoof-and-mouth diseasemassachuset language
...View all with 19 letters...
Words (17)
overenthusiasticallyhypersensitivenessescomprehensiblenessesforethoughtfulnessesphiloprogenitivenessacetylcholinesterasephosphoenolpyruvatesphosphomonoesterasesincomprehensiblenesspseudocholinesteraseantiestablishmentismpseudoparenchymatousphotoreconnaissancesnephroangiosclerosishyperconsciousnessesdimethylnitrosaminesirreproachablenessesPhrases (117)
suborder strepsirhinibalaenoptera physalusbusiness relationshipstephen collins fosterbalance sheet analysissphenisciform seabirdneisseria gonorrhoeaepoor man's weatherglassmilton snavely hersheyschool superintendent
...View all with 20 letters...
Words (11)
disestablishmentarianimmunocytochemistriesstraightforwardnessesimmunoelectrophoresesestablishmentarianisminterchangeablenessesacetylcholinesterasesimmunoelectrophoresisincomprehensibilitiespseudocholinesterasesindistinguishablenessPhrases (107)
sir john everett millaisabelmoschus esculentushead and shoulders abovefrances hodgson burnettaleksandr solzhenitsynanthriscus cereifoliumphascolarctos cinereusarithmetic progressionequus hemionus hemionusintravenous anesthetic
...View all with 21 letters...
Words (6)
disestablishmentariansimmunohistochemistriesphiloprogenitivenessesincomprehensiblenessesencephalomyocarditisesestablishmentarianismsPhrases (91)
schlumbergera truncatusleishmaniasis americanaaleksandr i. solzhenitsyninstrument of punishmentarthur meier schlesingergotthold ephraim lessingsamuel langhorne clemensengraulis encrasicholusadenosine monophosphatesaint matthew the apostle
...View all with 22 letters...
Words (1)
indistinguishablenessesPhrases (64)
parenthetical expressiontransient ischemic attackhippoglossus stenolepsisaristolochia serpentariahenri emile benoit matissetyrosine kinase inhibitorrichard brinsley sheridansan carlos apache languagecervus elaphus canadensisepinephelus adscensionis
...View all with 23 letters...
Words (1)
intercomprehensibilitiesPhrases (63)
argyroxiphium sandwicensebattle of the spanish armadaarthur meier schlesinger jr.existentialist philosophyfranz seraph peter schuberthypersensitivity reactioncharles augustus lindberghcharles camille saint-saensbahasa kebangsaan languagealgernon charles swinburne
...View all with 24 letters...
Words (2)
phosphatidylethanolaminesantiestablishmentarianismPhrases (59)
mary wollstonecraft shelleybattle of the chemin-des-damescruel and unusual punishmentdistinguished service medalboris leonidovich pasternakrudolf christian karl dieselwar of the spanish successionmelanerpes erythrocephalusherpes simplex encephalitissir arthur stanley eddington
...View all with 25 letters...
Phrases (46)
helen maria fiske hunt jacksonfrances eliza hodgson burnettnational institutes of healthwar of the austrian successionjames abbott mcneill whistlerjohn burdon sanderson haldaneemployee stock ownership plansir charles scott sherringtonunited nations children's fundparthenocissus quinquefolia
...View all with 26 letters...
Phrases (28)
nikita sergeyevich khrushchevaleksandr sergeyevich pushkinaugustus welby northmore puginfreedom from search and seizurejerusalem artichoke sunflowerpull the wool over someone's eyesdeoxyadenosine monophosphatecryptobranchus alleganiensistaras grigoryevich shevchenkohomo sapiens neanderthalensis
...View all with 27 letters...
Phrases (36)
aleksandr feodorovich kerenskyephippiorhynchus senegalensismarcus junius brutus the youngercommission on the status of womenfederal housing administrationludwig josef johan wittgensteinsergei mikhailovich eisensteindissident irish republican armyjacques alexandre cesar charlesamerican staffordshire terrier
...View all with 28 letters...
Phrases (22)
aleksandr nikolayevich scriabindisorganized type schizophreniacapital of the russian federationhydrangea macrophylla hortensisconstitution of the united statesstephanus johannes paulus krugerpresident william henry harrisonsecond epistle to the corinthiansgeorges joseph christian simenonarrhenius theory of dissociation
...View all with 29 letters...
Phrases (20)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library sciencedouble standard of sexual behaviorjacques anatole francois thibaultaugust friedrich leopold weismannwaterhouse-friderichsen syndromeplasma thromboplastin antecedentmucocutaneous lymph node syndrome
...View all with 30 letters...
Phrases (16)
united states public health servicesecond epistle to the thessaloniansmarie louise elisabeth vigee-lebrunsir john frederick william herschelanicius manlius severinus boethiusislamic jihad movement in palestineoscar fingal o'flahertie wills wildefrancoise-athenais de rochechouartcommonwealth of independent statesfibrocystic disease of the pancreas
...View all with 31 letters...
Phrases (9)
nikolai andreyevich rimski-korsakovhierarchical classification systemsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovtheory of electrolytic dissociationyevgeni aleksandrovich yevtushenkowilhelm apollinaris de kostrowitzkiprogressive emphysematous necrosisattorney general of the united statesPhrases (13)
epistle of paul the apostle to philemonorganization of the oppressed on earthelizabeth cleghorn stevenson gaskellmusculus sphincter ductus choledochisir winston leonard spenser churchillkonstantin sergeyevich stanislavskydisease of the neuromuscular junctionmercury-in-glass clinical thermometersecretary of health and human servicespositron emission tomography scanner
...View all with 33 letters...
Phrases (13)
jacques francois fromental elie halevychronic obstructive pulmonary diseaseepistle of paul the apostle to the romansinterstitial cell-stimulating hormonemusculus sphincter ductus pancreaticifriedrich august kekule von stradonitzdryopithecus rudapithecus hungaricusmassachusetts institute of technologydepartment of health and human serviceseinstein's general theory of relativity
...View all with 34 letters...
Phrases (9)
national baseball hall of fame and museumjohann christoph friedrich von schillercommunications security establishmentcomte donatien alphonse francois de sadehereditary motor and sensory neuropathytransurethral resection of the prostatesubacute sclerosing leukoencephalitisselective-serotonin reuptake inhibitorunited states naval research laboratoryPhrases (7)
sisters of the order of saint basil the greatsecretary of housing and urban developmentkarl friedrich hieronymus von munchhausendefense advanced research projects agencyepistle of paul the apostle to the ephesiansepistle of paul the apostle to the galatianscongregation of the sisters of saint hedwig