Words Containing: E,R,N,E,A,N
(In Any Order)
There are 2,950 words,
4,740 phrases and
0 abbr's with
E,R,N,E,A,N in.
Best Scoring Words With: E,R,N,E,A,N
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| reannex | 7 | 14 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| ensnare | 7 | 7 | verbv | |||||
verb • take or catch as if in a snare or trap • catch in or as if in a trap | ||||||||
| rennase | 7 | 7 | ||||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (38)
entranceandersenmanneredendangernazarenegangreneardennesensnaredenhancermenanderrevenantnarceinenearnessunearnedensnaresremanentremannedbanneredensnarerrennasesgennakeranserinebanneretannealerlanneretenauntervenereangenerantnarceensengravenenrangedenrangesenrankedenraungelernaean
...View all with 8 letters...
Phrases (2)
in one earinner earWords (105)
permanententertainendurancegreenlandresonancetangerineendearingentrancedperennialrepentantcentenarygrenadinechannelerunlearnedrefinancecanneriesnanometreengrainednemerteannectarineenchanterrenascentdecennarycannoneertanneriesensnarledgangrenedentrainedentrainerreannexednectareanrevenantsenhancerscanyoneerrechannel
...View all with 9 letters...
Phrases (10)
in earnestlena horneearned runrenal veinsnake fernin generaltrue sennagreen beanneural netcan openerWords (195)
generationunderneathadrenalineendangeredgeneratingrepentanceunansweredgovernanceentrapmentvenerationincineratepermanenceendearmentpreplannedhearteningmeanderingdinnerwareprovenancereengagingpermanencyparisiennecreatininerepugnanceunmanneredtransiencecontraveneserenadingscreenlandrepanelingcovenanterunreasonedgrandniecerelearningveneratingbarrenness
...View all with 10 letters...
Phrases (45)
edna o'brienbase runneranne bronteone-man ruleland tenureocean linerjean racinejeanne d'arcgenus irenarunner bean
...View all with 10 letters...
Words (311)
concentratethreateningarrangementunnecessaryinheritancepermanentlyrenaissanceentertainednetherlandsneanderthalentertainerpenetratingincineratedintoleranceinnumerablestrangenessreincarnatereenactmentalexandrinenecromancerenchantressbreadwinnerinterchangeimpermanentunderhandedmountaineeranswerphoneinteragencytransgenderunrepentantfreelancingneutropenianonreactivederangementincremental
...View all with 11 letters...
Phrases (66)
bean counterin agreementroentgen rayurban centerurban legendgene sarazendinner plateeaster bunnymelange yarnkaren blixen
...View all with 11 letters...
Words (441)
presentationkindergartenentertainingconcentratedunreasonablefrankensteinveterinarianpenitentiarygovernmentalregenerationtransferenceinvulnerablesubterraneanapprehensionnortheasterndegenerationinterminableendangermentremunerationfermentationtranscendentguaranteeingreassignmentunrestrainedfrankincenserecognizancerejuvenationimpermanencerecognisanceintrauterinerejuvenatingnewspapermanregeneratinginternalizednomenclature
...View all with 12 letters...
Phrases (141)
grain cleanercarniolan beejan tinbergentenant farmerperoneal veinearnest moneymessenger rnadeverbal nounstephen cranekitchen range
...View all with 12 letters...
Words (443)
entertainmentenvironmentaldeterminationmediterraneanunnecessarilyencouragementexterminationinconsideratequestionnaireinadvertentlyconfederationexterminatingreinstatementinterpersonalreorientationreintegrationunconquerableindeterminatetranscendenceunconsecratednonreturnablepreponderancedishearteningrenegotiationoverabundanceunpresentabletransgenderedrenegotiatingintransigencerearrangementexternalizingsensorineuralunregeneratedtricentennialunrepentantly
...View all with 13 letters...
Phrases (200)
bedside mannerfire insuranceline engravingarnold toynbeeturbinate bonespiny anteaterinverse secantcarved in stonemachine gunneralan jay lerner
...View all with 13 letters...
Words (448)
recommendationinterpretationunderstandablerepresentationreconnaissanceunderstatementantidepressantunrecognizablenewspaperwomaninterplanetaryaforementionedtranscendentalmountaineeringnebuchadnezzarinternationalecounterbalancegeneralizationpredestinationunpreparednessarrondissementprearrangementunderachievinggovernmentallyreasonablenessnonthreateningunrecognisablegeneralisationinconsiderableaggrandizemententertaininglynoncooperativedisenfranchisenonperformancedefenestrationinterpenetrate
...View all with 14 letters...
Phrases (275)
negeri sembilangarageman's liensurface tensionrenaissance manresistance unitgenus negaprioninverse tangentwinsorized meannavy departmentroger bannister
...View all with 14 letters...
Words (407)
experimentationenvironmentallyentrepreneurialdisenfranchisedinterchangeableunpronounceabledifferentiationmisapprehensionparthenogenesisdifferentiatingplenipotentiaryneoconservativeenfranchisementnonexperimentalcounterargumentreapportionmentundemonstrativereinvestigatingadventurousnessreconcentrationnearsightednessincommensurablereconsiderationcontemporaneousinconsideratelycounterbalancednongovernmentalunderhandednessdiphenhydramineexternalizationkindheartednesssemitransparentindeterminationdownheartednessconsiderateness
...View all with 15 letters...
Phrases (390)
centaurea cyanushigh renaissanceprivate nuisancealpine sunflowerbattle of ravennaencelia farinosagentleman-at-armshorned chameleonentente cordialegenus anthoceros
...View all with 15 letters...
Words (185)
intercontinentalenvironmentalistneurotransmitterenvironmentalismcountersignaturetriphenylmethanerepresentationalcounterespionagehyperventilationreinterpretationunreasonablenessdemineralizationovercompensationinterpretationalinterventricularpredeterminationunattractivenessundifferentiateddecentralizationunderachievementexternalisationscounterstatementexternalizationsunmannerlinessesextraneousnessesantiuniversitiesunpreparednesseslandlubberlinessthermoremanenceshyperventilatingpardonablenessescommensuratenessroentgenographicinordinatenessesnonproprietaries
...View all with 16 letters...
Phrases (401)
tympanic membranein a beastly mannergenus angiopterischelonian reptiledefinite integralin an elaborate waynathaniel currierbusiness relationgenus periplanetaprotestant deacon
...View all with 16 letters...
Words (150)
depersonalizationmisinterpretationintergovernmentaltranscendentalismmisrepresentationcontemporaneouslytranscendentalistinappropriatenessuncomfortablenessinterrelationshipinterdepartmentalcountersignaturescounterstatementsinformativenesseskindheartednessesdisfranchisementsinheritablenesseshyperventilationsself-determinationdisintermediationinoperativenessescrestfallennessesinscrutablenessesnonreappointmentspentachlorophenolrecentralizationsinseparablenessestenderheartednesscomplementarinesspentylenetetrazolmachine-controlledantireligiousnessextraordinarinessnonsuperimposablereconceptualizing
...View all with 17 letters...
Phrases (437)
jacqueline cochrandame margot fonteynmary leontyne pricecompetence hearinglandscape gardenerczech monetary unitnikolaas tinbergenhandicapped personcenter of attentionhorned rattlesnake
...View all with 17 letters...
Words (87)
disenfranchisementoverrepresentationinterchangeabilityhypersensitizationmisinterpretationsinharmoniousnessesmisrepresentationsdishonorablenessesfaintheartednesseslandlubberlinessesrambunctiousnessesunprofitablenessesunreasonablenessesapprehensivenessesdisintermediationsunrestrainednessespentachlorophenolspentylenetetrazolsnonrepresentativescounterbombardmentnonrevolutionariestranscendentalismstranscendentalistsvaingloriousnessesinsufferablenessespertinaciousnessesmagnetoresistancespredestinarianismsconservativenessesdedifferentiationsgedankenexperimentreinstitutionalizecounterreformationpremillenarianismsremunerativenesses
...View all with 18 letters...
Phrases (386)
american revolutionanamnestic reactionjohn orley allen taterenaissance revivalnathaniel hawthorneinterior decoratingsecond cranial nerveinterior decorationinterior departmentgenus encephalartos
...View all with 18 letters...
Words (67)
countertransferencepneumoencephalogramdisenfranchisementshypersensitizationscountersurveillanceextraordinarinessesparthenogeneticallycomplementarinessesreconceptualizationresorcinolphthaleincounterdemonstratorcytodifferentiationgedankenexperimentsreinstitutionalizedreinstitutionalizesmercury-contaminatedtridimensionalitiesinterdepartmentallyadventuresomenessescontradictorinessesrepresentationalismrepresentationalistthree-dimensionalitydemonstrativenessespreternaturalnessesmethylcholanthrenesovercentralizationsinappropriatenessescontemporaneousnessdepartmentalizationpenicillin-resistantphotointerpretationrevolutionarinessescounteradvertisingsoverdifferentiation
...View all with 19 letters...
Phrases (361)
measuring instrumentseventeen-year locustread between the lineszairese monetary unitshakespearean sonnetorganization expensedelusions of grandeurgentlemen's agreementdecreasing monotonicpounds per square inch
...View all with 19 letters...
Words (32)
counterrevolutionaryparadichlorobenzeneskeratoconjunctivitescountersurveillancescountertransferencesunrepresentativenessunsatisfactorinessesreconceptualizationscounterdemonstrationcytodifferentiationsphenylpropanolaminesinterchangeabilitiesrepresentationalismsrepresentationalistsrepresentativenessesinappreciativenessesanthropocentricitiesdepartmentalizationsincommensurabilitiesphotointerpretationsoverdifferentiationsroentgenographicallyinconsiderablenessesphotoreconnaissancescounterdemonstratingcounterdemonstratorsindiscriminatenessesnephroangiosclerosisunderrepresentationsdimethylnitrosaminesirreconcilablenessesextemporaneousnessesPhrases (339)
sweet-scented geraniumpelecanus onocrotalusappendicular skeletonprofessional relationlebanese monetary unitmultilinear evolutionlunar excursion modulebusiness relationshipwalther hermann nernstbyelorussian language
...View all with 20 letters...
Words (12)
disestablishmentarianestablishmentarianisminterchangeablenessesneuroendocrinologicalcontemporaneousnessesarenaria-melanocephalacountercountermeasurecounterdemonstrationsoverintellectualizingantiferromagneticallyundemonstrativenessescounterinterpretationPhrases (292)
administrative hearingelimination tournamentsierra nevada mountainsfrances hodgson burnettexperimental conditionicelandic monetary unitaleksandr solzhenitsynspontaneous generationtelephone conversationnondirectional antenna
...View all with 21 letters...
Words (12)
counterrevolutionarieskeratoconjunctivitidespentamethylenetetrazolkeratoconjunctivitisesdisestablishmentariansunrepresentativenessesnonrepresentationalismhexamethylenetetraminecountercountermeasuresdihydroxyphenylalanineestablishmentarianismscounterinterpretationsPhrases (256)
venezuelan monetary unitgregorian calendar monthprunus persica nectarinatransient global amnesialeishmaniasis americanaaleksandr i. solzhenitsynjohn ronald reuel tolkienmultiple mononeuropathyteacher-student relationguatemalan monetary unit
...View all with 22 letters...
Words (3)
nonrepresentationalismshexamethylenetetraminesoverintellectualizationPhrases (176)
gilbert and ellice islandsparenthetical expressiontransient ischemic attackchlorpheniramine maleateto all intents and purposesyellowstone national parkparis-sorbonne universitylewis and clark expeditionhenri emile benoit matisseantoine laurent de jussieu
...View all with 23 letters...
Words (1)
overintellectualizationsPhrases (177)
basque homeland and freedomcarnegie mellon universitylowland burrowing treefrogargyroxiphium sandwicensedivision heterokontophytasir terence mervyn rattiganfrancois auguste rene rodincapital of northern irelanddmitri ivanovich mendeleevhunting and gathering tribe
...View all with 24 letters...
Words (1)
antiestablishmentarianismPhrases (150)
count ferdinand von zeppelincluster of differentiation 4diamond wedding anniversarycruel and unusual punishmentcentral intelligence agencyfast local internet protocolboris leonidovich pasternakwar of the spanish successionantonio allegri da correggioamerican baptist convention
...View all with 25 letters...
Phrases (99)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanfrances eliza hodgson burnettx-linked dominant inheritancepolicing and enforcement costalternanthera philoxeroidescorrectional rehabilitationhunting and gathering societywar of the austrian successionanton grigorevich rubinstein
...View all with 26 letters...
Words (1)
ethylenediaminetetraacetatePhrases (68)
business environment analysispartial differential equationamerican revolutionary leaderaleksandr sergeyevich pushkinelectromechanical transducersolenostemon scutellarioidesaugustus welby northmore puginbeta-adrenergic blocking agentelectronic musical instrumentnuclear regulatory commission
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (78)
interstate commerce commissionaleksandr feodorovich kerenskybureau of engraving and printingephippiorhynchus senegalensismarcus junius brutus the youngerbattles of lexington and concordcapital of serbia and montenegrofederal housing administrationdepartment of homeland securitymaster of arts in library science
...View all with 28 letters...
Phrases (65)
business environmental analysisbusiness interruption insurancealeksandr nikolayevich scriabinchemical decomposition reactionacrylonitrile-butadiene-styreneantisocial personality disordermale internal reproductive organnational volunteers associationdisorganized type schizophreniacombination in restraint of trade
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (47)
valentina vladmirovna tereshkovaalexander isayevich solzhenitsynglutamic oxalacetic transaminaseself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligencecoluber constrictor flaviventrisjacques anatole francois thibaultvicomte ferdinand marie de lessepsethylenediaminetetraacetic acid
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (50)
bureau of intelligence and researchfreedom from involuntary servitudepetroselinum crispum neapolitanumguiseppe fortunino francesco verdiunited states department of defensetupac amaru revolutionary movementsidonie-gabrielle claudine coletteunited states trade representativefrances elizabeth caroline willardrevolutionary proletarian nucleus
...View all with 31 letters...
Words (1)
tetrabromo-phenolsulfonephthaleinPhrases (26)
nikolai andreyevich rimski-korsakovafrican american vernacular englishpeople against gangsterism and drugspatent and trademark office databasedepartment of the federal governmentweakly interacting massive particleintercontinental ballistic missilestraight-line method of depreciationrevolutionary justice organizationobject-oriented programing language
...View all with 32 letters...
Phrases (29)
linear-quadratic-gaussian controllermusical instrument digital interfaceautonomous sensory meridian responsebreach of trust with fraudulent intentinternational maritime organizationstandard generalized markup languagelycopersicon esculentum cerasiformeobject-oriented programming languageorganization of the oppressed on earthmusculus obliquus externus abdominis
...View all with 33 letters...
Phrases (30)
jacques francois fromental elie halevyrelational database management systemconfidential adviser-advisee relationchronic obstructive pulmonary diseasefederal national mortgage associationacademy of television arts and sciencesnero claudius caesar drusus germanicusinterstitial cell-stimulating hormonemusculus sphincter ductus pancreaticifriedrich august kekule von stradonitz
...View all with 34 letters...
Phrases (27)
national technical information servicejohann christoph friedrich von schillercommunications security establishmentinternational development associationunited states postal inspection servicetadeusz andrzej bonawentura kosciuszkorevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycomte donatien alphonse francois de sade
...View all with 35 letters...
Phrases (17)
center for disease control and preventionrank-difference correlation coefficientjakob ludwig felix mendelssohn-bartholdyangiotensin-converting enzyme inhibitorforeign intelligence surveillance courtfield-sequential color television systemfreedom from cruel and unusual punishmentalbert francis charles augustus emmanuelsecretary of health education and welfarecriminal intelligence services of canada
...View all with 36 letters...
Phrases (16)
severe combined immunodeficiency diseaseunited states declaration of independencetheodore roosevelt memorial national parkuniversity of north carolina at chapel hillattention deficit hyperactivity disordercentre for international crime preventiongenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentacademy of motion picture arts and sciences
...View all with 37 letters...
Phrases (8)
general certificate of secondary educationunited states government accounting officeobject-oriented database management systemdemocratic republic of sao tome and principeeconomic commission for asia and the far eastdepartment of housing and urban developmentadvanced research and development activityminimally invasive coronary bypass surgeryPhrases (11)
million floating point operations per secondbillion floating point operations per seconddefense reutilization and marketing serviceislamic jihad for the liberation of palestinedirectorate for inter-services intelligencerespiratory distress syndrome of the newborngates of the arctic national park and preservenucleoside reverse transcriptase inhibitorpopular front for the liberation of palestinebaron hermann ludwig ferdinand von helmholtz
...View all with 39 letters...
Phrases (9)
minnesota multiphasic personality inventoryrevolutionary proletarian initiative nucleinational archives and records administrationprayer of azariah and song of the three childrenregents of the university of california v. bakkeinternational relations and security networkursulines of mary immaculate virgin of gandinofirst of october antifascist resistance grouptrillion floating point operations per secondPhrases (7)
pearson product-moment correlation coefficientarmy high performance computing research centerpaul ludwig von beneckendorff und von hindenburgbasal body temperature method of family planningdemocratic front for the liberation of palestinenon-nucleoside reverse transcriptase inhibitorbaron friedrich heinrich alexander von humboldtPhrases (7)
national oceanic and atmospheric administrationtransmission control protocol/internet protocolcooper union for the advancement of science and artfirst amendment to the united states constitutionarmenian secret army for the liberation of armeniamedical literature analysis and retrieval systeminternational society for krishna consciousnessPhrases (6)
abul-walid mohammed ibn-ahmad ibn-mohammed ibn-roshdassociation for the advancement of retired personsprayer of azariah and song of the three holy childrenconte alessandro giuseppe antonio anastasio voltafirst epistle of paul the apostle to the corinthiansunited states army criminal investigation commandPhrases (6)
international bank for reconstruction and developmentfourteenth amendment to the united states constitutionfood and agriculture organization of the united nationsunited nations international children's emergency fundroyal society of london for improving natural knowledgeunited society of believers in christ's second appearing
