Words Containing: E,R,K,I,L,Y
(In Any Order)
There are 95 words,
262 phrases and
0 abbr's with
E,R,K,I,L,Y in.
Best Scoring Words With: E,R,K,I,L,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| jerkily | 7 | 21 | adverb, adjectiveadv, adj | |||||
adverb • with spasms • with jerking motions | ||||||||
| perkily | 7 | 16 | adverb, adjectiveadv, adj | |||||
adverb • in a perky manner | ||||||||
| raylike | 7 | 14 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| yolkier | 7 | 14 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (16)
hyperkalemiaholidaymakerhyperlinkingflickeringlydaydreamlikekremlinologyrevokabilityfairnytickleblackish-greygreyish-blackfernytickleshydraulickedbreakabilitylocksmitheryquicksilverykeratohyalinPhrases (11)
alfred kinseyliterary workcylinder lockvery much likeslippery dickmercy killingreality checkrayleigh diskliterary hacksilky terrier
...View all with 12 letters...
Words (11)
marketabilityholidaymakerskindheartedlyblackberryingfairnyticklesjawbreakinglyremarkabilitypoikilothermyforeknowinglyprickly-leafedprickly-leavedPhrases (13)
el iskandriyahrichard leakeysilky wisteriakillarney ferncylinder blockorkney islandstrofim lysenkocheckered lilybrake cylindercycle rickshaw
...View all with 13 letters...
Words (7)
breathtakinglyearthshakinglyhydrokineticalblackberry-lilyblackberryingshuckleberryingyekaterinoslavPhrases (17)
veliky novgorodkyrgyz republicbishop berkeleyfamily akeridaestanley kubrickrockrose familyearly wake-robinhydraulic brakesquirrel monkeybrooklyn bridge
...View all with 14 letters...
Phrases (1)
technical analysis of stock trendsPhrases (1)
great smoky mountains national parkPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay
