Words Containing: E,N,L,E,Y
(In Any Order)
There are 1,922 words,
2,527 phrases and
0 abbr's with
E,N,L,E,Y in.
Best Scoring Words With: E,N,L,E,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| queenly | 7 | 19 | adverb, adjectiveadv, adj | |||||
adjective satellite • having the rank of or resembling or befitting a queen | ||||||||
| xylenes | 7 | 17 | nounn | |||||
noun • a colorless flammable volatile liquid hydrocarbon used as a solvent | ||||||||
| xylene | 6 | 16 | nounn | |||||
noun • a colorless flammable volatile liquid hydrocarbon used as a solvent | ||||||||
| keenly | 6 | 13 | adverbadv | |||||
adverb • in a keen or penetrating way | ||||||||
| henleys | 7 | 13 | nounn | |||||
noun • A type of knit shirt with a front placket but no collar | ||||||||
| evenly | 6 | 12 | adverb, adjectiveadv, adj | |||||
adverb • in equal amounts or shares; in a balanced or impartial way • in a level and regular way | ||||||||
| henley | 6 | 12 | nounn | |||||
noun • A type of knit shirt with a front placket but no collar | ||||||||
| spleeny | 7 | 12 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| myeline | 7 | 12 | ||||||
noun • a white fatty substance that forms a medullary sheath around the axis cylinder of some nerve fibers | ||||||||
| amylene | 7 | 12 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (58)
recentlyentirelyheavenlydecentlytenderlyeyelinerleniencyclemencykennellyunseemlynewlywedunevenlywesleyanbenchleyethyleneserenelygreenflyelegancydeprenylfelinelyhymenealsenilelypolygeneequinelyjejunelylegendryteryleneunmeetlyamylenestelegonypolyenespolyteneeyeblinkkernellymyelines
...View all with 8 letters...
Phrases (3)
eye blinkhenry leeallen keyWords (122)
generallylegendarysincerelyevidentlygenuinelyseeminglyendlesslyeternallypresentlyenjoyableintenselyimmenselyelegantlyearnestlygenealogyferventlyglycerineacetyleneeminentlypolytheneobscenelyjellybeaninverselytelephonyrelevancyalleghenyfeelinglypensivelygenteellylenientlypropylenemoneylessslenderlymethylenegoldeneye
...View all with 9 letters...
Phrases (13)
henry lucehoney belljelly beannellie blygene kellypineal eyeleyden jareye cliniclyre snakemoney belt
...View all with 9 letters...
Words (177)
definitelyeventuallyunemployedemploymentscreenplayelementaryexcellencyfrequentlydeploymentgenerouslyinherentlyneedlesslynegativelyunderbellyexternallyeloquentlyvehementlyconverselyindecentlyepicondyleconcretelyobedientlytunelesslyresiliencycoherentlyinexpertlyyellownessdementedlyerlenmeyerfleetinglygeneralitysneeringlyreverentlylonesomelydesignedly
...View all with 10 letters...
Phrases (28)
aniline dyeyemeni rialjohn wesleymetal moneyabney leveldesert lynxhelen hayeschunky heeldry cleaneryemeni fils
...View all with 10 letters...
Words (271)
differentlynecessarilyessentiallypermanentlygeneticallyyellowstoneexceedinglyefficientlydelinquencyextensivelyattentivelygentlemanlyeventualitymoneylenderhoneysuckleequivalencydeliverymanpolystyreneintensivelyexcellentlycontentedlydefensivelyoffensivelyyellowknifechancelleryirrelevancyexpedientlysenselesslyexpensivelyalternatelytentativelycompetentlyerroneouslyexpectantlydeservingly
...View all with 11 letters...
Phrases (55)
elinor wylieenergy levelsingle entryledger entryaeolian lyrelevy en masseemily brontepay envelopecurly endivemelange yarn
...View all with 11 letters...
Words (280)
unemploymentunexpectedlyunbelievablyindefinitelyencyclopediatremendouslyconsequentlysubsequentlydefinitivelyconvenientlyrelentlesslyclytemnestraelectrifyingincoherentlypersistentlyrefreshinglytheophyllineunemployableinadequatelyphenomenallybelligerencyphylogeneticinfrequentlyunreservedlypolyurethaneevidentiallybeneficiallyeffeminatelydepressinglyencyclopedicsequentiallyredeploymentbenevolentlytetracyclineindelicately
...View all with 12 letters...
Phrases (80)
genus glycineread-only filelienal arteryedmond halleytennis playeredmund halleyalben barkleypetit larcenytenpenny naileleanor gwynn
...View all with 12 letters...
Words (290)
unnecessarilyexceptionallyindependentlyinterestinglyinadvertentlyexponentiallyintelligentlycomplementaryalternativelysupplementaryeverlastinglyconsecutivelynorthwesterlyencyclopaediaindifferentlyenergeticallyungentlemanlydependabilitypredominatelyeccentricallysentimentallyinsensitivelyadrenalectomyincompetentlyineffectuallyinefficientlyexistentiallyceremoniouslyinexpensivelyunrelentinglymeaninglesslyacetylcholineunconcernedlyinexpressiblyroentgenology
...View all with 13 letters...
Phrases (118)
neglect of dutyarnold toynbeealan jay lernerjekyll and hydecooley's anemiaacrylate resinvolleyball netgenus cyclamendna polymeraserudolf nureyev
...View all with 13 letters...
Words (257)
intellectuallyaffectionatelyelectronicallyoverwhelminglysentimentalityinterplanetaryhyperventilatenitroglycerineintermittentlyconservativelyexperimentallygovernmentallyinconvenientlyencephalopathyintermediatelyentertaininglydifferentiallypyelonephritisdepartmentallytelephonicallypreferentiallyanesthesiologyextortionatelyoverpoweringlypreponderantlyineffectualityabsentmindedlycomprehensiblydiscontentedlydepolymerizingdenumerabilitygenerationallyhypermasculinepolybutadieneshypoallergenic
...View all with 14 letters...
Phrases (142)
field intensitybattle of nasebymoonseed familydimethyl ketonedrunken revelrycooley's anaemiablended whiskeycanterbury bellchinese parsleyoriental cherry
...View all with 14 letters...
Words (197)
environmentallyanaesthesiologydevelopmentallyintellectualityparentheticallyplenipotentiarycondescendinglymaneuverabilitymethylphenidateencephalographyintrospectivelyuninterruptedlydemonstrativelyunceremoniouslyheartbreakinglyunprecedentedlyinconsideratelycomprehensivelytemperamentallyinterrogativelysymmetricalnessperpendicularlyoxytetracyclinekinestheticallyheterogeneouslyunadulteratedlycontemplativelycomplementaritytenderheartedlymethylxanthinesserendipitouslyunintelligentlynonbelligerencydishearteninglyelectroanalysis
...View all with 15 letters...
Phrases (194)
benefit of clergyalimentary pastehelen wills moodyebony spleenwortfamily lemnaceaewassily leontieferlenmeyer flaskpipeline companygempylus serpenscanterbury tales
...View all with 15 letters...
Words (83)
incomprehensiblytriphenylmethanehyperintelligenthyperventilationquintessentiallyphylogeneticallyextemporaneouslyhymenophyllaceaenoncompetitivelyhypersomnolencesantiunemploymentapocryphalnesseshyperventilatingperpendicularitylyginopteridalesstereophonicallygastroenterologycyclohexylaminesoxyphencycliminekinaestheticallycytotechnologiesunrespectabilityoligodendrocytesconsequentialityphenylethylaminephenylketonuriasphenylketonuricsgeneralizabilityneurasthenicallyorthogeneticallyadenohypophysealneurohypophysealintercrystallineprerevolutionaryinterdependently
...View all with 16 letters...
Phrases (240)
hypodermic needlein a beastly mannerin an elaborate waycommercial agencybattle of the boynefamily balaenidaenevil shute norwaymechanical systemvery low frequencylaundry stiffener
...View all with 16 letters...
Words (50)
perchloroethylenecontemporaneouslyinconsequentiallyisoelectronicallyunexchangeabilityhyperventilationschlortetracyclineferrimagneticallymorphogeneticallyencephalomyelitispentylenetetrazollymphadenopathieshyperalimentationtrichloroethyleneimmunogeneticallyelectronegativitythiodiphenylaminephenylethylamineselectroanalyticalnephelometricallydehydrochlorinasedehydrochlorinatetriphenylmethaneshyperintelligenceneurophysiologiesneuropsychologiesmethylnaphthalenecomprehensibilitydeoxyribonucleaseretroperitoneallydepolymerizationspalaeoethnographyintersubjectivelyone-dimensionalityentrepreneurially
...View all with 17 letters...
Phrases (260)
mary leontyne pricebalaena mysticetusproteolytic enzymemary mcleod bethunehypoglycemic agentpearly everlastingcylinder separatorexecutive clemencycaesarian deliveryanemone sylvestris
...View all with 17 letters...
Words (43)
inconsequentialityhyperaldosteronisminterchangeabilitypolyesterificationmethyltestosteroneelectrodynamometerpolyribonucleotidenoncomprehensivelypentylenetetrazolscylindrical-stemmedperchloroethyleneshyperbilirubinemiadiethylmalonylureacounterintuitivelymagnetostrictivelyphenomenologicallydehydrochlorinasesdehydrochlorinateddehydrochlorinatesneuroendocrinologytrichloroethylenesgranulocytopoiesespolypropenonitrilerepresentationallymethylcholanthrenemethylnaphthalenesmethylprednisolonedeoxyribonucleasespropertylessnessesroentgenologicallychlortetracyclinestetrachlorethylenesedimentologicallycounterdeploymentschlamydomonadaceae
...View all with 18 letters...
Phrases (229)
dame sybil thorndikelachrymal secretionjohn orley allen tateread-only memory chipkilocycle per secondmegacycle per secondfulminate of mercuryfamily loranthaceaevictory celebrationfamily magnoliaceae
...View all with 18 letters...
Words (33)
polyesterificationspolyribonucleotideshypolipoproteinemiaparthenogeneticallyphenomenalisticallyphenylthiocarbamideechoencephalographyelectrodynamometersinterconvertibilityphosphoenolpyruvateinterdepartmentallyelectromagneticallyelectromechanicallyinterferometricallythree-dimensionalitymethylcholanthrenesmethylprednisolonesdeoxyribonucleotideelectroretinographyincomprehensibilitymicroelectronicallyencephalomyelitidesphenylpropanolaminehydroxytetracyclinetetrachloroethylenetetrafluoroethyleneoverproportionatelydiethylcarbamazinestetramethyldiarsinedimethylnitrosaminehyperemotionalitiesdimethyltryptaminesexpressionisticallyPhrases (200)
seventeen-year locustalpine type of glaciergiles lytton stracheycost-benefit analysissubfamily mephitinaejapanese honeysucklefamily zingiberaceaealben william barkleyedna st. vincent millaysolitary confinement
...View all with 19 letters...
Words (14)
counterrevolutionaryoverenthusiasticallypolyphiloprogenitivephenylpropanolaminesphenylthiocarbamidesacetylcholinesterasephosphoenolpyruvateshyperlipoproteinemiadeoxyribonucleotidesroentgenographicallyencephalomyocarditissyncategorematicallydimethylnitrosaminesexistentialisticallyPhrases (201)
william stanley jevonslebanese monetary unitbalaenoptera physalusdevelopmental anatomybalance sheet analysisbyelorussian languagebenjamin henry latrobemilton snavely hersheymagnetic bubble memoryclassifying adjective
...View all with 20 letters...
Words (4)
alkylbenzenesulfonateacetylcholinesterasespolyvinyl-formaldehydeantiferromagneticallyPhrases (136)
icelandic monetary unitelectrolytic condenseraleksandr solzhenitsyndesoxyribonucleic acideucalyptus fraxinoidesextremely low frequencyfamily rhinotermitidaeprocaine hydrochloridespeech intelligibilityhans holbein the younger
...View all with 21 letters...
Words (6)
pentamethylenetetrazolintercomprehensibilityelectroencephalographyhexamethylenetetramineencephalomyocarditisesdihydroxyphenylalaninePhrases (136)
venezuelan monetary unitlycopersicon esculentumredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynfamily dendrocolaptidaemultiple mononeuropathyloyalist volunteer forcehigh-density lipoprotein
...View all with 22 letters...
Words (3)
polytetrafluoroethylenehexamethylenetetramineshypobetalipoproteinemiaPhrases (95)
family threskiornithidaegeorge macaulay trevelyanmeperidine hydrochlorideyellowstone national parkbangladeshi monetary unitrichard brinsley sheridantricyclic antidepressanteastern malayo-polynesianamerican federalist partywestern malayo-polynesian
...View all with 23 letters...
Words (2)
hyperbetalipoproteinemiaphosphatidylethanolaminePhrases (70)
carnegie mellon universityunidentified flying objectprivately held corporationzollinger-ellison syndromealexandre emile jean yersinfluoxetine hydrocholorideexistentialist philosophyalfred edward woodley masonfederal republic of germanyhenry wadsworth longfellow
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (63)
myroxylon balsamum pereiraemary wollstonecraft shelleyfrancis scott key fitzgeraldcentral intelligence agencyedmund john millington syngepropoxyphene hydrochloridemelanerpes erythrocephalusreligious society of friendstrans-alaska pipeline systempyotr alexeyevich kropotkin
...View all with 25 letters...
Phrases (46)
brassica oleracea gongylodesemployee stock ownership planevelyn arthur saint john waughassyrian neo-aramaic languagecharles maurice de talleyrandrevolutionary calendar monthbenign prostatic hyperplasiapalestine national authoritymyrtillocactus geometrizansgilles de la tourette syndrome
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (37)
business environment analysisamerican revolutionary leaderholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinorder of our lady of mount carmelaugustus welby northmore puginco-operative republic of guyanacommissioned military officernuclear regulatory commission
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (33)
revolutionary people's strugglealeksandr feodorovich kerenskyephippiorhynchus senegalensistriphosphopyridine nucleotideoxytetracycline hydrochloridedepartment of homeland securitymaster of arts in library sciencedissident irish republican armyrevolutionary communist leaguecount lev nikolayevitch tolstoy
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (26)
business environmental analysisaleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderedward george earle bulwer-lyttoninternational olympic committeemiddle east respiratory syndromehydrangea macrophylla hortensislydia kamekeha paki liliuokalanipresident william henry harrison
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (25)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligenceethylenediaminetetraacetic acidbalance of international paymentspolymonium caeruleum van-bruntiae
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (11)
freedom from involuntary servitudetupac amaru revolutionary movementrevolutionary proletarian nucleusrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyerinternational atomic energy agencymarie anne charlotte corday d'armontinternational intelligence agencymarine corps intelligence activityhuygens' principle of superposition
...View all with 31 letters...
Phrases (13)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovuniversity of california at berkeleytheory of electrolytic dissociationyevgeni aleksandrovich yevtushenkofederal emergency management agency
...View all with 32 letters...
Phrases (13)
lycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavaright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human serviceshighly active antiretroviral therapyinternational law enforcement agencycapital: critique of political economy
...View all with 33 letters...
Phrases (10)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesmassachusetts institute of technologyerasable programmable read-only memoryeinstein's general theory of relativityeinstein's special theory of relativitycomputerized axial tomography scannerrevolutionary armed forces of colombiaPhrases (11)
communications security establishmentrevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence serviceimmaculate conception of the virgin marynational socialist german workers' partydepartment of defense laboratory systemfraxinus pennsylvanica subintegerrimasecurity intelligence review committee
...View all with 35 letters...
Phrases (7)
university of north carolina at chapel hillgenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentkarl friedrich hieronymus von munchhausensixteen personality factor questionnaireunited states national library of medicinePhrases (1)
enzyme-linked-immunosorbent serologic assay
