Words Containing: E,M,E,E
(In Any Order)
There are 4,455 words,
4,218 phrases and
0 abbr's with
E,M,E,E in.
Best Scoring Words With: E,M,E,E
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| extreme | 7 | 16 | adjectiveadj | |||||
noun • the furthest or highest degree of something • the point located farthest from the middle of something adjective satellite • of the greatest possible degree or extent or intensity • far beyond a norm in quantity or amount or degree; to an utmost degree • beyond a norm in views or actions • most distant in any direction | ||||||||
| lexemes | 7 | 16 | nounn | |||||
noun • a minimal unit (as a word or stem) in the lexicon of a language; `go' and `went' and `gone' and `going' are all members of the English lexeme `go' | ||||||||
| lexeme | 6 | 15 | nounn | |||||
noun • a minimal unit (as a word or stem) in the lexicon of a language; `go' and `went' and `gone' and `going' are all members of the English lexeme `go' | ||||||||
| smeeked | 7 | 14 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| eyebeam | 7 | 14 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| meekest | 7 | 13 | adjectiveadj | |||||
adjective satellite • humble in spirit or manner; suggesting retiring mildness or even cowed submissiveness • very docile • evidencing little spirit or courage; overly submissive or compliant | ||||||||
| meeker | 6 | 12 | adjectiveadj | |||||
adjective satellite • humble in spirit or manner; suggesting retiring mildness or even cowed submissiveness • very docile • evidencing little spirit or courage; overly submissive or compliant | ||||||||
| eyesome | 7 | 12 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| freemen | 7 | 12 | nounn | |||||
noun • a person who is not a serf or a slave | ||||||||
| bedemen | 7 | 12 | ||||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (77)
extremeelementemergedvermeerdemeterpreemiemeniereemendeddemesnedemergenemesesmergeesmeekestenemiesmeeterslexemesmenteesgleemeneremiteeyesomemeseemsredeemsfreemenmeteredemeutesbeseemsbedemenseedmensmeekedreedmenseemersepimeremesteeseyebeamtelemen
...View all with 7 letters...
Phrases (1)
elm treeWords (172)
rememberdecembercemeteryemployeeelementssemesterpremiereresembletemperedomeletteeminenceembeddedesteemeddementedredeemedensembleredeemertenementmerengueeasementmeeknessevermoreembezzlemiserereemergentremediedmemberedpermeatevehementenameledenmeshedhelmetedmuleteerreemergegermfree
...View all with 8 letters...
Phrases (11)
reed macelime treeneem treefree timehemp seedseek timeeye rhymerem sleepmule deerneem cake
...View all with 8 letters...
Words (320)
somewhereemergencyextremelyagreementseptemberdeterminemessengerperimeterexcrementmadeleinebethlehemmeteoritebumblebeemusketeerelementaltelemetryempoweredemergenceephemeralembezzledredeemingpeacetimenevermoreremodeledpremieredtemperatepermeateddefermentmesenterymenageriemesmerizereexaminemeyerbeerpedometersegmented
...View all with 9 letters...
Phrases (37)
mt. everest9-memberedlemon peelbeer makerex temporedeer mousejames ageemake senseflame tree6-membered
...View all with 9 letters...
Words (546)
themselvesexperimentdeterminedengagementexcitementretirementsettlementelementaryvietnameseresentmenthemispherecentimetertumbleweedcemeteriesclementinecompetenceeffeminaterefinementgamekeeperpreemptivereferendumbettermentmesmerizedmesmerisedreassemblepermanencerecompensetemperancecerebellumvehementlyendearmentpeacemakermeddlesomedenouementcentimetre
...View all with 10 letters...
Phrases (62)
emery paperjerked meatjerome kernthree timesgenus melesjesse jamesopen sesameelement 104element 105element 106
...View all with 10 letters...
Words (637)
temperaturedevelopmentreplacementrememberingmasterpieceenforcementachievementresemblancerequirementexterminatemercenariesthermometerimplementedtemperamentmeasurementremembranceendorsementrefreshmentsmithereensbereavementenhancementreenactmentgendarmerieminesweeperenslavementoppenheimermoneylendersmokescreenmantelpieceentitlementempowermentspeechmakerappeasementforevermoreawesomeness
...View all with 11 letters...
Phrases (109)
summer sweetcomte de saxein agreementgeorge meadeemerald islemesua ferreatriple cremefemale cheststeam engineelapsed time
...View all with 11 letters...
Words (694)
mademoiselleexperimentaldisagreementincompetenceimpenetrablepremeditatedexterminatedsledgehammerembezzlementintermediateteleprompterresettlementcommencementoverestimateendangermentelectrometercinemathequeimpertinenceexperimenterspectrometerimpermanenceenthronemententanglementundetermineddisemboweledcomplementedunencumberedpresentimentdensitometerhomelessnessbewildermentcompletenessirredeemablemisrepresentdenouncement
...View all with 12 letters...
Phrases (148)
graham greenemount everestmarcel breuermeeting placeearnest moneyfellow membermessenger rnasecond empiretout ensemblemoderate gale
...View all with 12 letters...
Words (584)
entertainmentunderestimatemediterraneanenlightenmentencouragementadvertisementcomprehensivereinforcementcircumferencetemperamentalmagnetospherepredeterminedoverestimatedreimbursementdevelopmentalredevelopmentkapellmeisterreinstatementdismembermentshamelessnesstelemarketingimperceptibleembellishmentindeterminatedisembowelledoverstatementgentlemanlikedisengagementrearrangementhermeneuticaltelevangelismrematerializereplenishmentdeterminativechameleonlike
...View all with 13 letters...
Phrases (218)
might-have-beenbedside mannercreme de menthegenus empetrumrobert m. yerkesskeletal framelolium perenneambrose biercececil b. demillefetal membrane
...View all with 13 letters...
Words (513)
understatementunpremeditatedcomprehensibleaforementionedincompletenesspermissivenessmisrepresentedcountermeasuredematerializedexperimentallyintermediariesprearrangementmesdemoisellesmephistophelesovercompensateextemporaneousimperativenesssentimentalizeintermediatelyendarterectomyelectrochemistinterferometrydematerialiseddisembowelmentoveremphasizedindeterminabledivertissementmicrometeoritesentimentaliseshamefacednessundeterminablemeddlesomenessimmoderatenessrecommencementcomprehendible
...View all with 14 letters...
Phrases (287)
negeri sembilanpearl mae baileyimperative verbclementine treesales agreementdimethyl ketoneimperial decreeemergency brakeboehmeria niveamembrane filter
...View all with 14 letters...
Words (378)
electromagneticexperimentationmethamphetamineacknowledgementspermatogenesisbioluminescencecompetitivenessdevelopmentallymeaninglessnessenfranchisementmethylphenidatestereochemistrystereoisomerismnonexperimentalgentlemanlinessexcrementitiousexperimentalismsentimentalizedcomprehensivelytemperamentallyincomprehensiveelectrochemicalemotionlessnesswarmheartednesstempestuousnesshomogeneousnessredeterminationimpassivenessesoverassessmentsreestablishmentinhomogeneitiesnonachievementsproximatenessesindeterminaciesoverhomogenizes
...View all with 15 letters...
Phrases (338)
measuring devicefamily lemnaceaefamily arecaceaebessemer processmeat thermometerhigh temperaturetidewater streamhorned chameleoncubic centimetrechemical defense
...View all with 15 letters...
Words (179)
incomprehensibleelectromagnetismunderdevelopmenttriphenylmethanechemotherapeuticelectromagneticsstereomicroscopeextemporaneouslyepiphenomenalismabsentmindednesselectrochemistrypredeterminationunderachievementcounterstatementhymenophyllaceaeuncomprehensibleunmannerlinessesdisentanglementshypersomnolencesheterometabolismnoncomprehensiveheterometabolouslamentablenessesradiotelemetriesthermoremanencesinimitablenessesappendicectomiesrampageousnessescommensuratenesscomparablenessespostexperimentalfathomlessnessesjungermanniaceaecompatiblenessesmotherlessnesses
...View all with 16 letters...
Phrases (353)
hypodermic needlemultiengine planecommedia dell'artecartridge removerfamily cyperaceaestephane mallarmenerve compressionperformative verbgenus chaenomelesdiesel locomotive
...View all with 16 letters...
Words (123)
intergovernmentalmisrepresentationchemiluminescencecomprehensivenesselectromechanicaldextroamphetamineinterdepartmentalcounterstatementsthermoluminescentcomfortablenessesinflammablenessesunmelodiousnessesunmitigatednessesinformativenessesserious-mindednesscommonplacenessesmisrepresentativeself-determinationcomparativenessescompendiousnessescompetitivenessesencephalomyelitiscomplementarinessstereochemistriescomplementaritiesillimitablenessescomplicatednessesstereomicroscopesmachine-accessibleimaginativenessescerebromeningitisimmunocompetencespermissiblenessesventuresomenessesimperturbableness
...View all with 17 letters...
Phrases (394)
mary leontyne pricecompetence hearingclomiphene citrateproteolytic enzymemary mcleod bethunepast-tense morphemebessemer converterspecial assessmentasbestos abatementmiguel de cervantes
...View all with 17 letters...
Words (76)
disenfranchisementthermoluminescencemethyltestosteroneelectrodynamometerspectrophotometersnoncomprehensivelymisrepresentationscommunicablenessesfeeblemindednessesmuddleheadednessescomprehensiblenesscurmudgeonlinessesimmeasurablenessesimmunodeficienciesmagnetoresistanceshypercholesteremiaabsentmindednessessaccharomycetaceaemyeloproliferativegedankenexperimentmalcontentednessesaccumulativenesseschemotherapeuticalmanipulativenesseselectrochemistriestriboluminescencesmechanochemistriesremunerativenessesimperceptivenessesimperishablenessescontemptiblenessescontemptuousnesseselectroluminescentsuperconglomerateselectromyographies
...View all with 18 letters...
Phrases (374)
family physeteridaewet-bulb thermometerimperfective aspectgeorge michael cohanmember of parliamentsir mortimer wheelerinterior departmentottmar mergenthaleralan alexander milnepooecetes gramineus
...View all with 18 letters...
Words (57)
pseudohermaphroditeelectroluminescencepneumoencephalogramthermoluminescencesdisenfranchisementsthermoperiodicitiesspectrophotometriescommunicativenessescompanionablenessescompassionatenessesencephalomeningitiscomplementarinessescomprehensibilitiescomprehensivenessesimmunofluorescencesgedankenexperimentsaccommodativenessesgentlemanlikenesseselectrodynamometerscontemplativenessesinterdepartmentallyadventuresomenessesrepresentationalismelectromagneticallyobsessive-compulsiveelectromechanicallyphosphomonoesteraseelectrometallurgiesinterferometricallymeningoencephaliticthree-dimensionalitydemonstrativenessesoverambitiousnessesmeningoencephalitiselectrophoretograms
...View all with 19 letters...
Phrases (321)
robert emmet sherwoodsierra madre orientalmillimeter of mercurycollective agreementfamily lepisosteidaezairese monetary unitgentlemen's agreementexecutive departmentstephen michael reichfamily tropaeolaceae
...View all with 19 letters...
Words (21)
hypercholesterolemiaelectroencephalogramspectrofluorometriesabetalipoproteinemiacomprehensiblenessesglomerulonephritideselectroluminescencesrepresentationalismsbuckminsterfullerenephosphomonoesteraseshyperlipoproteinemiadestructive-metabolicincomprehensiblenessmicroelectrophoresesmicroelectrophoresismicroelectrophoreticchemotherapeuticallyindiscriminatenesseshypercholesterolemicheterobasidiomycetesextemporaneousnessesPhrases (284)
sweet-scented geraniumorder mycelia sterilialebanese monetary unitorder myxobacterialesdouble-reed instrumentdevelopmental anatomywalther hermann nernstfamily dermochelyidaepierre simon de laplaceambrose gwinett bierce
...View all with 20 letters...
Words (12)
immunoelectrophoresesimmunoelectrophoreticelectroencephalogramscontemporaneousnessesmeningoencephalitidesbuckminsterfullerenesimmunoelectrophoresisincomprehensibilitiesarenaria-melanocephalacountercountermeasureundemonstrativenesseshypercholesterolemiasPhrases (260)
sir john everett millaissierra madre occidentalabelmoschus esculentusexperimental conditionexecution of instrumentconfederate rose mallowmultiplicative inverseketorolac tromethamineliquefied petroleum gasconfession of judgement
...View all with 21 letters...
Words (9)
pentamethylenetetrazolnonrepresentationalismintercomprehensibilitycarboxymethylcellulosehexamethylenetetramineincomprehensiblenessesencephalomyocarditisescountercountermeasuresmicrospectrophotometerPhrases (188)
venezuelan monetary unitlycopersicon esculentumredevelopment authorityitalian vegetable marrowequal-area map projectionfoeniculum vulgare dulcebattle of the bismarck seaathyrium thelypteroidesenterobius vermicularisfriedrich wilhelm bessel
...View all with 22 letters...
Words (5)
nonrepresentationalismscarboxymethylcelluloseshexamethylenetetramineshypobetalipoproteinemiamicrospectrophotometersPhrases (146)
second battle of el alameingeorge macaulay trevelyanchlorpheniramine maleatemeperidine hydrochlorideelectromechanical devicetweedledum and tweedledeeapium graveolens rapaceumclassified advertisementeuropean recovery programgottfried wilhelm leibniz
...View all with 23 letters...
Words (5)
hyperbetalipoproteinemiaintercomprehensibilitiesmicroelectrophoreticallymicrospectrophotometriesschizosaccharomycetaceaePhrases (108)
basque homeland and freedomcarnegie mellon universitylouis seymour bazett leakeypelham grenville wodehousezollinger-ellison syndromesir terence mervyn rattigandmitri ivanovich mendeleevarthur meier schlesinger jr.gottfried wilhelm leibnitzalexandre emile jean yersin
...View all with 24 letters...
Words (1)
immunoelectrophoreticallyPhrases (98)
myroxylon balsamum pereiraemary wollstonecraft shelleymiguel de cervantes saavedrabattle of the chemin-des-dameschemical weapons conventionbrassica oleracea gemmiferadistinguished service medalfriedrich wilhelm nietzschesternocleidomastoid musclemelanerpes erythrocephalus
...View all with 25 letters...
Phrases (81)
helen maria fiske hunt jacksonx-linked dominant inheritanceconfederate states of americapolicing and enforcement costmalignant neoplastic diseasejames abbott mcneill whistleremployee stock ownership planunited arab emirates's capitaltrespass quare clausum fregitgeorg wilhelm friedrich hegel
...View all with 26 letters...
Words (1)
ethylenediaminetetraacetatePhrases (59)
business environment analysisamerican revolutionary leaderholy roman emperor frederick iielectromechanical transduceroffice of management and budgetsolenostemon scutellarioidesfreedom from search and seizureelectronic musical instrumentjerusalem artichoke sunflowerpull the wool over someone's eyes
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (58)
interstate commerce commissioncapital of serbia and montenegrodemocratic republic of the congodepartment of homeland securitymaster of arts in library sciencesergei mikhailovich eisensteinrevolutionary communist leagueface-amount certificate companysmall computer system interfacesodium carboxymethyl cellulose
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (49)
business environmental analysischemical decomposition reactionmale internal reproductive organfriedrich wilhelm august froebelsao thome e principe monetary unitinternational olympic committeemiddle east respiratory syndromeferdinand joseph la menthe mortonunited arab emirate monetary unitbaron de la brede et de montesquieu
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (34)
valentina vladmirovna tereshkovamusculus sternocleidomastoideusreduced instruction set computingobsessive-compulsive personalitydepartment of energy intelligencevicomte ferdinand marie de lessepsethylenediaminetetraacetic acidbalance of international paymentsmultiple correlation coefficientaugust friedrich leopold weismann
...View all with 30 letters...
Phrases (31)
freedom from involuntary servitudemarie louise elisabeth vigee-lebrunpetroselinum crispum neapolitanumunited states department of defensetupac amaru revolutionary movementsir john frederick william herschelmanipulative electronic deceptioninterstitial plasma cell pneumoniaanicius manlius severinus boethiuselectromotive drug administration
...View all with 31 letters...
Words (1)
tetrabromo-phenolsulfonephthaleinPhrases (25)
african american vernacular englishpeople against gangsterism and drugspatent and trademark office databasedepartment of the federal governmentweakly interacting massive particleintercontinental ballistic missilestraight-line method of depreciationobject-oriented programing languagesodium ethylmercurithiosalicylateisidore auguste marie francois comte
...View all with 32 letters...
Phrases (18)
musical instrument digital interfaceautonomous sensory meridian responsestandard generalized markup languageepistle of paul the apostle to philemonlycopersicon esculentum cerasiformeobject-oriented programming languageprivilege against self incriminationlaser-assisted in situ keratomileusisgeneral agreement on tariffs and tradefinancial crimes enforcement network
...View all with 33 letters...
Phrases (23)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseasefederal islamic republic of the comorosfederal national mortgage associationacademy of television arts and sciencesepistle of paul the apostle to the romansgeorge louis palmella busson du mauriernero claudius caesar drusus germanicusinterstitial cell-stimulating hormone
...View all with 34 letters...
Phrases (19)
national baseball hall of fame and museumnational technical information servicecommunications security establishmentinternational development associationrevolutionary organization 17 novembercomte donatien alphonse francois de sadeimmaculate conception of the virgin marymaxmillien marie isidore de robespierrehereditary motor and sensory neuropathyanti-imperialist international brigade
...View all with 35 letters...
Phrases (12)
jakob ludwig felix mendelssohn-bartholdysecretary of state for the home departmentangiotensin-converting enzyme inhibitorfield-sequential color television systemfreedom from cruel and unusual punishmenttripleurospermum oreades tchihatchewiialbert francis charles augustus emmanuelcriminal intelligence services of canadatiberius claudius drusus nero germanicusbaron karl maria friedrich ernst von weber
...View all with 36 letters...
Phrases (13)
severe combined immunodeficiency diseasefirst epistle of paul the apostle to timothytheodore roosevelt memorial national parkketoacidosis-resistant diabetes mellituscentre for international crime preventiondemocratic and popular republic of algeriatrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentacademy of motion picture arts and sciencesdepartment of health education and welfare
...View all with 37 letters...
Phrases (9)
united states government accounting officeobject-oriented database management systemsecond epistle of paul the apostle to timothyalexis charles henri maurice de tocquevilledemocratic republic of sao tome and principeeconomic commission for asia and the far eastmarie joseph paul yves roch gilbert du motierdepartment of housing and urban developmentadvanced research and development activityPhrases (7)
million floating point operations per seconddefense reutilization and marketing serviceislamic jihad for the liberation of palestinerespiratory distress syndrome of the newbornfuerzas armadas revolucionarios de colombiabaron hermann ludwig ferdinand von helmholtzenzyme-linked-immunosorbent serologic assayPhrases (6)
international bank for reconstruction and developmentnineteenth amendment to the united states constitutionfourteenth amendment to the united states constitutioneighteenth amendment to the united states constitutionunited nations international children's emergency fundroyal society of london for improving natural knowledge
