Words Containing: E,M,A,R,C,H,E
(In Any Order)
There are 521 words,
1,279 phrases and
0 abbr's with
E,M,A,R,C,H,E in.
Best Scoring Words With: E,M,A,R,C,H,E
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
mechanizer | 10 | 26 | verb, nounv, n | |||||
Valid word for Scrabble US
| ||||||||
bedchamber | 10 | 22 | nounn | |||||
noun • a room used primarily for sleeping | ||||||||
chamfered | 9 | 20 | verb, adjectivev, adj | |||||
noun • two surfaces meeting at an angle different from 90 degrees verb • cut a bevel on; shape to a bevel • cut a furrow into a columns | ||||||||
chamferers | 10 | 20 | ||||||
Valid word for Scrabble US
| ||||||||
aerenchyma | 10 | 20 | nounn | |||||
noun • A spongy, airy tissue found especially in the roots of aquatic plants | ||||||||
meerschaum | 10 | 19 | nounn | |||||
noun • a white clayey mineral • a pipe having a bowl made of meerschaum | ||||||||
archenemy | 9 | 19 | nounn | |||||
noun • A principal enemy. • A supreme and most powerful enemy. | ||||||||
chambered | 9 | 19 | adjectiveadj | |||||
adjective satellite • having compartmental chambers | ||||||||
preachment | 10 | 19 | nounn | |||||
noun • a sermon on a moral or religious topic | ||||||||
impeachers | 10 | 19 | nounn | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
machreeWords (26)
manchesterarchimedesmeerschaumbedchambertachometerpreachmentmerchantedimpeachershermeticalchamferersaerenchymamenarchealcharmeusesmechanizerrhamnaceaeanemochoremachmetersmechaniserhyperaemicchamberershexaemericpaper-machetachymeterpachymeterhexametrichemachromePhrases (5)
heavy creampeace marchscheme archeames chairfarm cheeseWords (59)
merchandisebeachcombercharlemagnespeechmakerbenchwarmerantechambermalebranchetacheometermerchantmenovermatchescheckmarkedbenchmarkedpreachmentsarchenemiesbedchambersmerchandizeaerenchymasovermatchedtheorematicmetanephricmachineriesschwarmereitachometersmeerschaumsamenorrheicmechanizersspermathecatrenchermanchampertiesherculaneumhemeralopicmolecatcherepicheiremacashiermenttacheometry
...View all with 11 letters...
Phrases (12)
memory cachemath teacherpreacher manchess masterheart musclefrom each onebeech martencrash helmetecho chambercream cheese
...View all with 11 letters...
Words (72)
chemotherapymerchandiserhermeticallyencroachmentmethacrylatereattachmentmerchandisedmerchantablehemerocallisjackhammeredmerchandisesmerchandizedadrenochromehemichordateschwarmereismesothoracesbenchwarmersbeachcombersantechambersspermathecaemetathoracescephalometryoveremphaticsclerenchymamerchandizesmerchantlikemerchantriesmoneychangerspeechmakersfranche-comtespermathecasechinodermalrheometricalmolecatchersroutemarched
...View all with 12 letters...
Phrases (27)
george m. cohangreek drachmamusic teacherxerox machinemurder chargedeutsche marksnake charmermachine riflemachine screwchristmas eve
...View all with 12 letters...
Words (73)
petrochemicalthermonuclearchloromethanehypercalcemiaencephalogramrapprochementhermeneuticalaeromechanicstracheotomiessaccharimetersaccharometerencroachmentsmerchandisershemisphericalheterogameticadrenochromeshemichordateshypermetricalhyperglycemiamarchionesseshypercalcemicneurochemicalhyperuricemiacephalometricsclerenchymashemacytometerreattachmentsmethacrylatesfranchisementrhamphothecaeschlumbergeramoneychangerstheorematicaltephromanciesramapithecine
...View all with 13 letters...
Phrases (39)
machine gunnerchicken manurechristmas treefemale monarchrhea americanachammy leathercatchment areajames michenercharter memberbubble chamber
...View all with 13 letters...
Words (79)
servomechanismhemerocalliseshypermasculineencephalogramsrapprochementsexothermicallymultichamberedstereochemicalelectrothermalhypermetabolicchemotherapieschemotherapistpetrochemicalscountermarchedcountermarchesmicrocephaliestracheostomiesthermochemicalsaccharimeterschordamesodermpneumothoraceshypercalcemiassaccharometersthermomagneticneurochemicalscholestyraminehyperuricemiasmagnetosphericcephalometrieschrestomathieshemacytometersrhombencephalahyperglycemiasfranchisementsmachaeranthera
...View all with 14 letters...
Phrases (50)
valet de chambreconnemara heatharithmetic meanmeister eckhartjames a. michenertorture chambertheater companygenus morchellaretail merchantpolychaete worm
...View all with 14 letters...
Words (62)
cinematographerenfranchisementelectrochemicalrhombencephalonechinodermatousmischaracterizemechanoreceptorservomechanismssaccharomyceteshermeneuticallyelectromyographchemotherapistschordamesodermsheliometricallyoverachievementhemochromatosesmicroearthquakecholestyraminesarchaebacteriumthermoremanenceheterochromaticheterochromatingeodemographicsinterchangementheterometabolictheorematicallychromaticnessespanhysterectomyendothermicallymicroaerophileschromatosphereshemicrystallineadiathermancieshypermetropicalhigh-performance
...View all with 15 letters...
Phrases (73)
horned chameleonambulance chasermerce cunninghamchemical processchemical reactormerchant vesselschattel mortgagealbert michelsonmandarin chinesebathroom cleaner
...View all with 15 letters...
Words (41)
chemotherapeuticelectromyographyunderachievementradiochemistriesspectroheliogramthermometricallymicrogametophytethermoremanencespharmacogeneticstrichloromethanemerchant-venturertricholomataceaemechanochemistrymechanoreceptionmechanoreceptivemechanoreceptorsturbomachinerieselectromyographsoverachievementselectropherogramthermoacidophiledisfranchisementmacrothelypterisheterochromatinselectrothermallythermoelectricalmicroearthquakeschampagne-ardennechemoprophylaxespseudoparenchymaenfranchisementsenterochromaffinperchloromethanesclerenchymatoushematocolpometra
...View all with 16 letters...
Phrases (82)
william wycherleyrendering machinechristmas diseaseafrican chameleonchristmas presentmechanical stressmythical creatureoscar hammersteinmargaret thatcheratmospheric state
...View all with 16 letters...
Words (27)
electromechanicalspectroheliogramsdisfranchisementsmorphogeneticallyrechromatographedmachine-controlledpharmacotherapiesnephelometricallyelectrochemicallyechoencephalogrammechanoreceptionsaerothermodynamicelectromyographicmerchantabilitiesentomophthoraceaeelectropherogramshemochromatosisescatecholaminergicthermogravimetricchemoautotrophieschemotherapeuticsimmunotherapeuticpseudoparenchymashaematocolpometraunderachievementshemerocallidaceaehaemorrhoidectomyPhrases (112)
competence hearingclomiphene citrateczech monetary unitmary mcleod bethuneline of merchandiseearth-received timearachnoid membranepurchase agreementlactogenic hormonecentral chimpanzee
...View all with 17 letters...
Words (18)
disenfranchisementthermoplasticitiesarchaeoastronomiesrechromatographiestrichlormethiazidehypercholesteremiasaccharomycetaceaeplasmodiophoraceaechemotherapeuticalmechanochemistriesaerothermodynamicselectromyographieselectrophoretogrammethylcholanthrenenitrochloromethanepseudoparenchymatatetrachloromethanediethylcarbamazinePhrases (111)
lachrymal secretiongeorge michael cohanread-only memory chipfamily trichechidaecerebral hemispherefamily loranthaceaechemical operationschristopher marlowesir william herscheloscar hammerstein ii
...View all with 18 letters...
Words (11)
pneumoencephalogramdisenfranchisementsparathyroidectomiesphenylthiocarbamideneuropharmacologieselectromechanicallyelectrophoretogramsmethylcholanthreneschlorofluoromethanehydrometeorologicaldiethylcarbamazinesPhrases (94)
stephen michael reichchinese monetary unitmathematical processarithmetic operationrepublic of the gambiafamily euphorbiaceaefamily morchellaceaethe great compromiserantidiuretic hormonemickey charles mantle
...View all with 19 letters...
Words (12)
hypercholesterolemiaelectroencephalogramspectrophotometricalparathyroidectomizedhyperadrenocorticismphenylthiocarbamidespseudohermaphroditicencephalomyocarditischemotherapeuticallychlorofluoromethanespseudoparenchymatousheterobasidiomycetesPhrases (101)
archeological remainsfamily trachipteridaefamily dermochelyidaesphenisciform seabirdmathematical relationamelanchier alnifoliametallographic samplenicolas de malebranchegaultheria procumbensdean gooderham acheson
...View all with 20 letters...
Words (4)
electroencephalogramselectromyographicallyarenaria-melanocephalahypercholesterolemiasPhrases (106)
acrocentric chromosomehelianthemum scopariumanthriscus cereifoliumhelichrysum bracteatumarchitectural ornamentketorolac tromethaminepharmaceutical chemistcapital of new hampshirearithmetic progressionfamily myrmecophagidae
...View all with 21 letters...
Words (3)
spectrophotometricallycarboxymethylcelluloseencephalomyocarditisesPhrases (107)
gregorian calendar monthschlumbergera truncatusbarbara wertheim tuchmanleishmaniasis americanaherbert marshall mcluhanbattle of the bismarck seagreco-roman architecturebrachycome iberidifoliaarthur meier schlesingeramelanchier bartramiana
...View all with 22 letters...
Words (2)
carboxymethylcellulosesdichlorodifluoromethanePhrases (60)
transient ischemic attackchlorpheniramine maleateelectromechanical devicepharmacological medicineintellectual nourishmentsearch and destroy missionwilliam cuthbert faulknerchrysanthemum partheniumdepartment of mathematicssuborder marginocephalia
...View all with 23 letters...
Words (3)
microelectrophoreticallydichlorodifluoromethanesschizosaccharomycetaceaePhrases (55)
argyroxiphium sandwicenseprimary sex characteristicdmitri ivanovich mendeleevarthur meier schlesinger jr.richard buckminster fullercomprehensive examinationcharles camille saint-saensmartha beatrice potter webbsir charles william siemenschrysosplenium americanum
...View all with 24 letters...
Words (1)
immunoelectrophoreticallyPhrases (43)
mary wollstonecraft shelleycruel and unusual punishmentdistinguished service medalmelanerpes erythrocephalusherpes simplex encephalitischarles frederick menningercommand processing overheadgreat plains of north americaorganic light-emitting diodehormone-replacement therapy
...View all with 25 letters...
Phrases (29)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanbattle of monmouth court housex-linked dominant inheritanceadrenocorticotropic hormonejames abbott mcneill whistlerhuman immunodeficiency virusemployee stock ownership planandrei dimitrievich sakharovcharles maurice de talleyrand
...View all with 26 letters...
Words (1)
ethylenediaminetetraacetatePhrases (28)
holy roman emperor frederick iielectromechanical transducerfreedom from search and seizurejerusalem artichoke sunfloweradrenocorticotrophic hormonesir frederick william herschelthrough empirical observationmachaeranthera tanacetifoliasystema nervosum periphericummikhail sergeyevich gorbachev
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (32)
marcus junius brutus the youngerdemocratic republic of the congofeodor mikhailovich dostoevskifeodor mikhailovich dostoevskydepartment of homeland securitysergei mikhailovich eisensteindissident irish republican armysodium carboxymethyl celluloseamerican staffordshire terriercoronoid process of the mandible
...View all with 28 letters...
Phrases (19)
chemical decomposition reactionfriedrich wilhelm august froebelcapital of the dominican republicsao thome e principe monetary unithydrangea macrophylla hortensisrene antoine ferchault de reaumurgeorges joseph christian simenontheory of punctuated equilibriumtripleurospermum tchihatchewiilauritz lebrecht hommel melchior
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (14)
ethylenediaminetetraacetic acidaugust friedrich leopold weismannwaterhouse-friderichsen syndromeplasma thromboplastin antecedentmucocutaneous lymph node syndromeesther hobart mcquigg slack morrisalfred charles william harmsworthsisters of st. michael the archangelmarie charlotte carmichael stopesmotion with variable acceleration
...View all with 30 letters...
Phrases (9)
sir john frederick william herschelanicius manlius severinus boethiusmaria luigi carlo zenobio cherubinirichard august carl emil erlenmeyermarie anne charlotte corday d'armontcharles andre joseph marie de gaullenorth american free trade agreementsecurities and exchange commissionmary godwin wollstonecraft shelleyPhrases (9)
jacques francois fromental elie halevychronic obstructive pulmonary diseasefederal islamic republic of the comorosinterstitial cell-stimulating hormonemusculus sphincter ductus pancreaticifederal home loan mortgage corporationdepartment of health and human servicesbaron hugh caswall tremenheere dowdingcomputerized axial tomography scannerPhrases (8)
secretary of state for the home departmentangiotensin-converting enzyme inhibitorfreedom from cruel and unusual punishmenttripleurospermum oreades tchihatchewiialbert francis charles augustus emmanuelsocialist people's libyan arab jamahiriyabaron karl maria friedrich ernst von weberdeclining balance method of depreciation