Words Containing: E,L,L,E,Y
(In Any Order)
There are 1,193 words,
1,655 phrases and
0 abbr's with
E,L,L,E,Y in.
Best Scoring Words With: E,L,L,E,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| sleekly | 7 | 14 | adverbadv | |||||
adverb • in a sleek glossy manner | ||||||||
| fleetly | 7 | 13 | adverb, adjectiveadv, adj | |||||
adverb • in a swift manner | ||||||||
| walleye | 7 | 13 | nounn | |||||
noun • strabismus in which one or both eyes are directed outward • pike-like freshwater perches | ||||||||
| levelly | 7 | 13 | adverbadv | |||||
Valid word for Scrabble US
| ||||||||
| hellery | 7 | 13 | ||||||
Valid word for Scrabble US
| ||||||||
| eyeball | 7 | 12 | nounn | |||||
noun • the ball-shaped capsule containing the vertebrate eye verb • look at | ||||||||
| elderly | 7 | 11 | adjectiveadj | |||||
noun • people who are old collectively adjective satellite • advanced in years; (`aged' is pronounced as two syllables) | ||||||||
| yelled | 6 | 10 | verbv | |||||
adjective satellite • in a vehement outcry | ||||||||
| leerily | 7 | 10 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| yellers | 7 | 10 | nounn | |||||
noun • someone who communicates vocally in a very loud voice | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (35)
cleverlywalleyedkennellyflywheelyellowedyodellervolleyedsleepilyreflexlyelatedlyselectlyveiledlyweasellyfelinelyvolleyersveltelysenilelyweevillyvelleityyodelledyellowereyeballswalleyeskernellyvalleyedleadenlyteleplayfleecilywilleyedbull's-eyekyriellegulleyedeyelevelredbellyjolleyerPhrases (4)
very welljelly egglady peelallen keyWords (80)
generallylifestylejewelleryendlesslyallegedlyeternallyleisurelyelegantlyuselesslyfederallybellyachegleefullyjellybeanalleghenyfeelinglyjellylikegenteellylenientlyblessedlyslenderlybelatedlyseverallyservilelyneedfullyheedfullyteleologytrolleyedeasefullyexaltedlyflywheelswelcomelypuerilelyyellowestrelaxedlyeyeballed
...View all with 9 letters...
Phrases (17)
alex haleyelihu yalehoney belljelly beanlead bellynellie blygene kellylife cycledoll's eyesbully beef
...View all with 9 letters...
Words (119)
completelyespeciallyeventuallypeacefullyexcellencyrelativelyhopelesslyneedlesslydelicatelycarelesslyhelplesslyrecklesslytirelesslyunderbellycheerfullyexternallyeloquentlyfearlesslyresolutelyselflesslyrecyclablerestlesslyseychellesseamlesslybelievablylifelesslytunelesslyyellownessdesolatelylawyerlikeheedlesslyclydesdalecerebrallyemployablefleetingly
...View all with 10 letters...
Phrases (32)
fleur-de-lysapple jellyrole playerheavy swellabney levelleydig celleaster lilygrace kellygrape jellyearly morel
...View all with 10 letters...
Words (170)
essentiallygeneticallyexclusivelyyellowstonemercilesslystorytellershamelesslyperpetuallygentlemanlyregretfullyselectivelyceaselesslydeceitfullyexcellentlyyellowknifechancelleryelectrolytesenselesslyelaboratelyalternatelyexplosivelyrepulsivelynoiselesslywensleydaledelightedlyreflexologyheartlesslynegligentlyelementallyreflexivelygenericallyperenniallylegendarilycollectedlyebulliently
...View all with 11 letters...
Phrases (52)
louis leakeyelinor wyliemary shelleyenergy levelaeolian lyreemmett kellyflute playerhenry milleryellow metalidler pulley
...View all with 11 letters...
Words (171)
deliberatelyunbelievablyrespectfullycollectivelyrelentlesslyeffortlesslylegitimatelyperipherallyelectricallytheophyllineunemployablebreathlesslyelectrolysisphenomenallybelligerencyhermeticallyevidentiallybeneficiallysequentiallyreflectivelybenevolentlyindelicatelyweightlesslyceremoniallydespitefullyfreneticallypolyethyleneecumenicallyfayettevilleestheticallyincompletelyirrelevantlyuneventfullyelectrolyticrevengefully
...View all with 12 letters...
Phrases (51)
read-only filefully fledgedbicycle wheelpoverty levellienal arteryjail deliveryedmond halleyedmund halleyalben barkleyelvis presley
...View all with 12 letters...
Words (164)
theoreticallyexceptionallyexponentiallyintelligentlyalternativelyeverlastinglybelievabilityaestheticallyenergeticallyungentlemanlyeccentricallysentimentallyineffectuallyexistentiallyunrelentinglymeaninglesslygeometricallyacetylcholinesuperlativelyreverentiallydeferentiallybelligerentlypolypropyleneclandestinelyhalfheartedlyunbelievinglyresplendentlypenitentiallybewilderinglydelectabilitydefenselesslydetrimentallyremorselesslytheophyllinesirreplaceably
...View all with 13 letters...
Phrases (65)
holy sepulcherholy sepulchrealan jay lernerjekyll and hydevolleyball netrose globe lilycelestial bodypays de la loireyosemite fallsartillery fire
...View all with 13 letters...
Words (134)
intellectuallywholeheartedlyelectronicallyoverwhelminglyexperimentallytelepathicallygovernmentallydifferentiallydepartmentallytelephonicallypreferentiallyempatheticallyillegitimatelydeliberativelygenerationallylightheartedlyhypoallergenicpolynucleotideheterophyllousgenealogicallymalcontentedlyegocentricallyintellectivelyacceleratinglyexploitativelyteleologicallyexothermicallyemblematicallynonelectrolyterecrystallizedrecrystallizesfeeblemindedlyadrenergicallyepigeneticallysimplemindedly
...View all with 14 letters...
Phrases (93)
pearl mae baileyskeletal systemlacrosse playercanterbury bellvolleyball gamefamily ulmaceaedizzy gillespieact reflexivelymost especiallytattletale grey
...View all with 14 letters...
Words (132)
environmentallydisrespectfullydevelopmentallyintellectualityparentheticallytherapeuticallyeuphemisticallytemperamentallyperpendicularlykinestheticallyunadulteratedlycontemplativelyemployabilitiespsychedelicallypoliomyelitidesunintelligentlynonbelligerencyelectroanalysisperipateticallyconsequentiallysculpturesquelyhypercoagulablenonelectrolytescyclohexylaminepolynucleotidestelegraphicallytetramethylleadlepidopterologyinterpersonallyirrepealabilityreduplicativelystereologicallyhermeneuticallyhexylresorcinolontogenetically
...View all with 15 letters...
Phrases (127)
class pelecypodahelen wills moodyfamily lemnaceaefamily leporidaewassily leontieferlenmeyer flasklymphatic vesselgeneral assemblycopper-base alloyadult female body
...View all with 15 letters...
Words (54)
hyperintelligentquintessentiallyphylogeneticallypolyelectrolyteshymenophyllaceaethermometricallyextracorporeallydimethylglyoximelyginopteridalesstereophonicallyecclesiasticallycyclohexylaminesstereoscopicallykinaestheticallyhypercellularityphenylethylamineleptotyphlopidaegeneralizabilityneurasthenicallyacetylsalicylateorthogeneticallyintercrystallineelectrohydraulicelectrolyticallybenzylpenicillinmeristematicallyinterjectionallyelectrophilicitymethylcellulosesintermolecularlyhendecasyllabicshendecasyllablesmyelomeningoceleelectrothermallyelectrotonically
...View all with 16 letters...
Phrases (134)
william wycherleyfamily balaenidaevolleyball playerfamily betulaceaefamily elateridaefamily blenniidaeorder polygonalessea-lettuce familygrand mal epilepsybellflower family
...View all with 16 letters...
Words (37)
perchloroethyleneelectrostaticallyinconsequentiallyisoelectronicallycercidiphyllaceaechlortetracyclineferrimagneticallymorphogeneticallyencephalomyelitispentylenetetrazoltrichloroethyleneimmunogeneticallyphenylethylamineselectroanalyticalnephelometricallyelectrochemicallyacetylsalicylateshyperintelligenceelectrometallurgymethylnaphthalenebacillariophyceaeelectrophysiologyretroperitoneallyheterotrophicallyentrepreneuriallydeterministicallyepidemiologicallyhydroelectricallyhydrometallurgiesepistemologicallyintraperitoneallyeleutherodactyluspiezoelectricallyunemployabilitieshyperintellectual
...View all with 17 letters...
Phrases (152)
pearly everlastingtheological systemfamily didelphidaemutually exclusivegreater yellowlegsfamily engraulidaeeugene curran kellyrosebay willowherborder thymelaealesmilitary volunteer
...View all with 17 letters...
Words (22)
polyribonucleotidepentylenetetrazolscylindrical-stemmedperchloroethylenesstereospecificallydiethylmalonylureadiethylstilbestrolmyeloproliferativephenomenologicallytrichloroethylenespolypropenonitrilerepresentationallyelectrooculographymethylcholanthrenemethylnaphthaleneselectrophysiologicmethylprednisoloneroentgenologicallychlortetracyclinestetrachlorethylenesedimentologicallysemiprofessionallyPhrases (163)
lachrymal secretionjohn orley allen tatekilocycle per secondsquirreltail barleyfamily polygalaceaefamily loranthaceaearchitectural stylefamily magnoliaceaetreaty of versaillesoysters rockefeller
...View all with 18 letters...
Words (23)
polyribonucleotidesparthenogeneticallydiethylstilbesteroldiethylstilboestrolphenomenalisticallyinterdepartmentallyelectromagneticallyelectromechanicallyinterferometricallyelectrophoreticallymethylcholanthrenesmethylprednisoloneselectrophysiologieselectrophysiologistmicroelectronicallyencephalomyelitidesphenylpropanolaminetetrachloroethylenehydrometeorologicaltetrafluoroethylenediethylstilbestrolspaleogeographicallyexpressionisticallyPhrases (120)
family cyclopteridaemillimeter of mercuryalpine type of glaciergiles lytton stracheyfamily lepisosteidaefamily tropaeolaceaefamily polypodiaceaeviral delivery vectorfamily eriocaulaceaecapital of seychelles
...View all with 19 letters...
Words (13)
hypercholesterolemiaoverenthusiasticallypolyphiloprogenitivephenylpropanolaminesacetylcholinesteraseelectrophysiologicalelectrophysiologistsroentgenographicallychemotherapeuticallysyncategorematicallyhypercholesterolemichypercoagulabilitiesexistentialisticallyPhrases (148)
william stanley jevonsyellow-shafted flickerwyethia amplexicaulisorder mycelia steriliafamily phytolaccaceaebalaenoptera physalusdevelopmental anatomybalance sheet analysisfamily dermochelyidaebyelorussian language
...View all with 20 letters...
Words (9)
stereomicroscopicallyalkylbenzenesulfonateacetylcholinesterasesphosphoglyceraldehydeelectromyographicallypolyvinyl-formaldehydeantiferromagneticallyhypercholesterolemiaspsychotherapeuticallyPhrases (105)
electrolytic condenseraleksandr solzhenitsynextremely low frequencyptolemy ii philadelphussamuel taylor coleridgespeech intelligibilityfamily grossulariaceaephylum platyhelminthesgeometrical regularitywilliam holmes mcguffey
...View all with 21 letters...
Words (7)
pentamethylenetetrazolspectrophotometricallyelectroencephalographyphosphoglyceraldehydescarboxymethylcelluloseelectrophysiologicallydihydroxyphenylalaninePhrases (86)
lycopersicon esculentumhaliaeetus leucorhyphusaleksandr i. solzhenitsynfamily dendrocolaptidaemultiple mononeuropathyloyalist volunteer forceedna saint vincent millaysamuel pierpoint langleytroglodytes troglodytesedward kennedy ellington
...View all with 22 letters...
Words (2)
carboxymethylcellulosespolytetrafluoroethylenePhrases (66)
george macaulay trevelyanyellowstone national parkeastern malayo-polynesiangeometrical irregularityartocarpus heterophylluswestern malayo-polynesiansir harry maclennan lauderauto-blocking belay devicelycopodium alopecuroidespsychosexual development
...View all with 23 letters...
Words (3)
electrocardiographicallyphosphatidylethanolaminemicroelectrophoreticallyPhrases (49)
carnegie mellon universitylouis seymour bazett leakeyprivately held corporationzollinger-ellison syndromealexandre emile jean yersinfluoxetine hydrocholorideexistentialist philosophyalfred edward woodley masonfederal republic of germanyhenry wadsworth longfellow
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (34)
myroxylon balsamum pereiraemary wollstonecraft shelleycentral intelligence agencyedmund john millington syngemelanerpes erythrocephalustrans-alaska pipeline systemmichelson-morley experimentlepidocybium flavobrunneumembryonic stem-cell researchreticuloendothelial system
...View all with 25 letters...
Phrases (26)
brassica oleracea gongylodesemployee stock ownership plancharles maurice de talleyrandrevolutionary calendar monthpalestine national authoritymyrtillocactus geometrizansgilles de la tourette syndromeconjunctival layer of eyelidsuniformly decelerated motionhereditary cerebellar ataxia
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (18)
american revolutionary leaderorder of our lady of mount carmelnuclear regulatory commissionpull the wool over someone's eyescryptobranchus alleganiensisprincipality of liechtensteinbaron lloyd webber of sydmontontopical prostaglandin eyedropuniversity of nebraska-lincolnhypothalamic releasing factor
...View all with 27 letters...
Phrases (21)
revolutionary people's struggleoxytetracycline hydrochloriderevolutionary communist leaguecount lev nikolayevitch tolstoyrevolutionary proletarian armysmall computer system interfacesodium carboxymethyl cellulosesingle nucleotide polymorphismimperial japanese morning gloryhypothalamic releasing hormone
...View all with 28 letters...
Phrases (17)
business environmental analysisaleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderedward george earle bulwer-lyttoninternational olympic committeehydrangea macrophylla hortensislydia kamekeha paki liliuokalanipresident william henry harrisonultrasonic pulse velocity tester
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (14)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligencebalance of international paymentspolymonium caeruleum van-bruntiaecalifornia personality inventory
...View all with 30 letters...
Phrases (10)
lycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavaright to speedy and public trial by jurymercury-in-glass clinical thermometerhighly active antiretroviral therapyinternational law enforcement agencycapital: critique of political economysubacute inclusion body encephalitisunited states intelligence communityphysiological jaundice of the newbornPhrases (1)
enzyme-linked-immunosorbent serologic assay
