Words Containing: E,L,L,A,Y
(In Any Order)
There are 2,643 words,
2,385 phrases and
0 abbr's with
E,L,L,A,Y in.
Best Scoring Words With: E,L,L,A,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| hazelly | 7 | 22 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| equally | 7 | 19 | adverbadv | |||||
adverb • to the same degree (often followed by `as') • in equal amounts or shares; in a balanced or impartial way | ||||||||
| flyleaf | 7 | 16 | nounn | |||||
noun • a blank leaf in the front or back of a book | ||||||||
| bleakly | 7 | 16 | adverb, adjectiveadv, adj | |||||
adverb • without hope | ||||||||
| flyable | 7 | 15 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| leakily | 7 | 14 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| calycle | 7 | 14 | nounn | |||||
noun • a group of bracts simulating a calyx as in a carnation or hibiscus • a small cup-shaped structure (as a taste bud or optic cup or cavity of a coral containing a polyp) | ||||||||
| cecally | 7 | 14 | adverbadv | |||||
Valid word for Scrabble US
| ||||||||
| clypeal | 7 | 14 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| falsely | 7 | 13 | adverb, adjectiveadv, adj | |||||
adverb • in an insincerely false manner • in an incorrect manner | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
alleyWords (49)
clearlygallerylegallyequallyallergylargelyeyeballcarlylefalselylangleyideallycleanlyplayletalertlysmalleyallayedwalleyeflyableregallyalloyedflyleafagilelypenallyallayervenallyloyalerretallybleaklygalleysvalleysleakilyrallyescalycleareallystalely
...View all with 7 letters...
Phrases (1)
sea lilyWords (91)
mentallysexuallysyllableverballyalleywayallegorywalleyedladylikelegalityreliablymediallylethallylawyerlygravellyladyloveseriallyplayableroleplaylinearlylatterlyraillerycalycealalderflyloyalesttallymenelatedlyfacilelyweasellyslayableblearilyepicallyallayerscalyclesrectallyretrally
...View all with 8 letters...
Phrases (7)
fern allyalley catsea hollypep rallylady peelallen keyalder flyWords (192)
carefullyliterallygenerallyspeciallyregularlyartilleryillegallyallegedlyeternallymedicallyaimlesslyelegantlyethicallyfearfullyfederallytearfullytolerablyhealthilyliberallycentrallybellyachejealouslysensuallylaterallyjellybeanbellybandwealthilypermalloysalesladyunequallylaryngealdamselflyalleghenyhypallageneutrally
...View all with 9 letters...
Phrases (34)
holy placealex haleyhell to payall the waylegal dutyroyal blueold baileyelihu yalebill haleyboyle's law
...View all with 9 letters...
Words (257)
absolutelyespeciallypersonallyeventuallyultimatelypeacefullyrelativelymelancholyvolleyballinternallygracefullyverticallypleasantlychemicallyterminallydreadfullystealthilydelicatelycarelesslyexternallyballplayerpainlesslyinfernallyfearlesslygratefullyheroicallymateriallymetallurgyflawlesslyphylloxerailliteracyrecyclableillegalitytastefullyethnically
...View all with 10 letters...
Phrases (62)
woody allenfamily linerift valleygolf playerapple jellyrole playerheavy swellblind alleyabney levellady killer
...View all with 10 letters...
Words (340)
technicallyessentiallybeautifullyemotionallypotentiallygeneticallyreluctantlyshamelesslyuniversallyreliabilityperpetuallygentlemanlycrystallinemarvelouslyceaselesslyerraticallyplayfulnesschancellerysphericallyangelicallypleasurablyelaboratelyalternatelyaerobicallyancestrallymelodicallyirregularlyempiricallymasterfullyidenticallyintolerablywensleydaleheartlesslycrystallizeskeptically
...View all with 11 letters...
Phrases (65)
louis leakeymary shelleyoryx gazellalike royaltyrailway lineaeolian lyreboulder claybattle royalalkyl halideflute player
...View all with 11 letters...
Words (412)
specificallyaccidentallydeliberatelyincidentallyunbelievablyeconomicallyhystericallyperiodicallycommerciallypatheticallyinexplicablycrystallizedmechanicallylegitimatelyperipherallyacademicallydomesticallyelectricallyunilaterallyemphaticallyterrificallyunemployablemethodicallybreathlesslypaleontologyecologicallyphenomenallyforensicallyconceptuallyhermeticallyartillerymantheatricallymonumentallymonosyllableproverbially
...View all with 12 letters...
Phrases (86)
william wylerread-only filemyrtle familytreasury billlienal arteryjail deliveryedmond halleyedmund halleyalben barkleymusical style
...View all with 12 letters...
Words (382)
intentionallytheoreticallyexceptionallyfundamentallyvulnerabilityrealisticallystrategicallyexponentiallycategoricallyspectacularlyalternativelyeverlastinglyideologicallysuperficiallyunequivocallybelievabilityaestheticallypreliminarilyunemotionallysensationallyenergeticallysymmetricallyungentlemanlygynecologicaldimensionallyeccentricallysentimentallyeducationallypalaeontologyineffectuallyexistentiallyqualitativelysyntheticallydiametricallymeaninglessly
...View all with 13 letters...
Phrases (130)
family laridaeadmiralty milealan jay lernerjekyll and hydeplum-yew familyvolleyball netedmund hillarylillie langtryamyloid plaquegustatory cell
...View all with 13 letters...
Words (314)
simultaneouslyprofessionallyscientificallyhypotheticallysystematicallyintellectuallycoincidentallymetaphoricallywholeheartedlyelectronicallydemocraticallymathematicallygeographicallyalphabeticallyconfidentiallyconventionallysupernaturallygynaecologicalexperimentallymetaphysicallytelepathicallygovernmentallydifferentiallyidealisticallyprovidentiallyorthopedicallydepartmentallyarchetypicallytelephonicallypreferentiallyetymologicallyethnologicallypaleopathologydisconsolatelyhyperbolically
...View all with 14 letters...
Phrases (158)
pearl mae baileywilliam tyndaleadmiralty metalskeletal systemlacrosse playercanterbury bellvolleyball gamevalerian familyfamily ulmaceaeclassical style
...View all with 14 letters...
Words (280)
internationallytechnologicallyunintentionallyenvironmentallysynergisticallydevelopmentallyintellectualityparentheticallyaerodynamicallytherapeuticallyinfinitesimallyinvulnerabilitycontroversiallyrecrystallizingseismologicallysympatheticallyarchitecturallydemographicallypalaeopathologyeuphemisticallypessimisticallytemperamentallyvoyeuristicallyperpendicularlykinestheticallyunsymmetricallybidirectionallyunadulteratedlynonspecificallycontemplativelyemployabilitiespsychedelicallyrevolutionarilyinterculturallyelectroanalysis
...View all with 15 letters...
Phrases (224)
class pelecypodafamily lemnaceaefamily leporidaegenus sylvilagusgenus bombycillalycosa tarentulawassily leontieffamily triglidaeerlenmeyer flaskfamily lophiidae
...View all with 15 letters...
Words (112)
enthusiasticallyquintessentiallyphylogeneticallypharmaceuticallyunapologeticallythermostaticallysurrealisticallyunprofessionallyconversationallyhymenophyllaceaecolorimetricallythermometricallyextracorporeallyparamagneticallypolyphyleticallycommonsensicallymalayo-polynesianglossopharyngealarchaeologicallymonotheisticallyarchiepiscopallybureaucraticallymorphometricallylyginopteridalesstenographicallydenominationallyflabbergastinglymulticellularityflexographicallystereophonicallyecclesiasticallycyclohexylaminesperiphrasticallyimmunochemicallystereoscopically
...View all with 16 letters...
Phrases (213)
william wycherleychemical analysishypophyseal stalkfamily locustidaecarya illinoensiswoolly plant lousefamily balaenidaevolleyball playerfamily betulaceaefamily elateridae
...View all with 16 letters...
Words (81)
bacteriologicallymaterialisticallyelectrostaticallythermodynamicallyinconsequentiallysocioeconomicallyisoelectronicallycercidiphyllaceaepolymorphonuclearkaleidoscopicallyspectroscopicallynonprofessionallychlortetracyclinemonosyllabicitiespaternalisticallyarchitectonicallyferrimagneticallymorphogeneticallylexicographicallycryptocrystallinelaryngopharyngealencephalomyelitiscrystallographerspentylenetetrazolcrystallographiesmicropaleontologyuncontroversiallyrecrystallizationimmunogeneticallyoceanographicallyonomatopoeticallyphenylethylaminesinteravailabilityelectroanalyticalnephelometrically
...View all with 17 letters...
Phrases (215)
salvia leucophyllapearly everlastingmalaysian languagetheological systemfamily trochilidaefamily didelphidaesubfamily loriinaesubfamily lutrinaemutually exclusivegreater yellowlegs
...View all with 17 letters...
Words (37)
characteristicallyhypercoagulabilityneuropsychologicalpolymorphonuclearspentylenetetrazolscylindrical-stemmedlipopolysaccharidestereospecificallystoichiometricallydiethylmalonylurearecrystallizationsmyeloproliferativephenomenologicallygeochronologicallyspectrographicallyrepresentationallyultracentrifugallymetallographicallyelectrooculographymethylcholanthrenemethylnaphthalenesultrarevolutionarypalaeoanthropologyroentgenologicallychlortetracyclinestetrachlorethylenehydrometallurgicalsedimentologicallyhydrometallurgistsphotosyntheticallyoveroptimisticallyintraventricularlysemiprofessionallyunenthusiasticallyneurophysiological
...View all with 18 letters...
Phrases (232)
bombycilla cedrorunlachrymal secretionjohn orley allen tatemary wollstonecraftmodal auxiliary verbsquirreltail barleyfamily polygalaceaeshort-term liabilityfamily loranthaceaearchitectural style
...View all with 18 letters...
Words (31)
cinematographicallyextralinguisticallyparthenogeneticallynonrelativisticallylipopolysaccharidesconceptualisticallybacteriochlorophyllphenomenalisticallyphosphatidylcholineinterdepartmentallyelectromagneticallyelectromechanicallyinterferometricallyimpressionisticallyelectrophoreticallymethylcholanthrenesanthropocentricallycharacterologicallymicroelectronicallyencephalomyelitidesphenylpropanolaminetetrachloroethylenehydrometeorologicaltetrafluoroethylenephytogeographicallypsychotomimeticallycytophotometricallyexhibitionisticallypaleogeographicallyexpressionisticallymultidimensionalityPhrases (191)
water-plantain familyacetylsalicylic acidfamily cyclopteridaefamily cynoglossidaealpine type of glaciergiles lytton stracheyfamily lepisosteidaefamily tropaeolaceaefamily polypodiaceaesalicylate poisoning
...View all with 19 letters...
Words (20)
uncharacteristicallyhypercholesterolemiaoverenthusiasticallylymphogranulomatosesimmunocytochemicallybacteriochlorophyllsphenylpropanolaminesacetylcholinesterasephosphatidylcholinesneurophysiologicallyneuropsychiatricallyelectrophysiologicalmicrocrystallinitiesroentgenographicallychemotherapeuticallymicrophotometricallysyncategorematicallyhypercoagulabilitiesplethysmographicallyexistentialisticallyPhrases (190)
william stanley jevonsyellow-shafted flickerwyethia amplexicaulisorder mycelia steriliafamily phytolaccaceaebalaenoptera physalusdevelopmental anatomybalance sheet analysisclyde william tombaughfamily dermochelyidae
...View all with 20 letters...
Words (12)
hypogammaglobulinemiastereomicroscopicallyalkylbenzenesulfonateacetylcholinesterasesphosphoglyceraldehydeotorhinolaryngologieselectromyographicallydendrochronologicallypolyvinyl-formaldehydeantiferromagneticallyhypercholesterolemiaspsychotherapeuticallyPhrases (121)
aleksandr solzhenitsyncynoglossum officinaleisle royal national parkcapital of pennsylvaniaptolemy ii philadelphussamuel taylor coleridgeagricultural chemistryfamily grossulariaceaecongenital abnormalityphylum platyhelminthes
...View all with 21 letters...
Words (7)
pentamethylenetetrazolspectrophotometricallyelectroencephalographyphosphoglyceraldehydescarboxymethylcelluloseelectrophysiologicallydihydroxyphenylalaninePhrases (109)
haliaeetus leucorhyphusaleksandr i. solzhenitsynfamily dendrocolaptidaemultiple mononeuropathyloyalist volunteer forceedna saint vincent millaysamuel pierpoint langleysomaliland monetary unitedward kennedy ellingtonbahasa malaysia language
...View all with 22 letters...
Words (2)
carboxymethylcellulosespolytetrafluoroethylenePhrases (78)
george macaulay trevelyanyellowstone national parkcalycanthus occidentalissciadopitys verticillataeastern malayo-polynesiangeometrical irregularityartocarpus heterophylluswestern malayo-polynesiansir harry maclennan lauderauto-blocking belay device
...View all with 23 letters...
Words (3)
electrocardiographicallyphosphatidylethanolaminemicroelectrophoreticallyPhrases (54)
carnegie mellon universitylouis seymour bazett leakeysubphylum cephalochordatamary wollstonecraft godwinprivately held corporationalexandre emile jean yersinexistentialist philosophyalfred edward woodley masonfederal republic of germanyhenry wadsworth longfellow
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (37)
myroxylon balsamum pereiraemary wollstonecraft shelleycentral intelligence agencymelanerpes erythrocephaluscaulophyllum thalictroidestrans-alaska pipeline systemlepidocybium flavobrunneumanthony charles lynton blairembryonic stem-cell researchreticuloendothelial system
...View all with 25 letters...
Phrases (28)
brassica oleracea gongylodesemployee stock ownership plancharles maurice de talleyrandrevolutionary calendar monthpalestine national authoritymyrtillocactus geometrizansgilles de la tourette syndromeconjunctival layer of eyelidsuniformly decelerated motionhereditary cerebellar ataxia
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (24)
american revolutionary leaderorder of our lady of mount carmelnuclear regulatory commissioncryptobranchus alleganiensisprincipality of liechtensteinhyacinthus orientalis albulusbaron lloyd webber of sydmontontopical prostaglandin eyedropfalkland islands monetary unitnikolai ivanovich lobachevsky
...View all with 27 letters...
Phrases (23)
revolutionary people's struggleoxytetracycline hydrochloriderevolutionary communist leaguecount lev nikolayevitch tolstoyrevolutionary proletarian armysmall computer system interfacesodium carboxymethyl celluloseimperial japanese morning glorypalestinian national authoritynonsteroidal anti-inflammatory
...View all with 28 letters...
Phrases (18)
business environmental analysisaleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderedward george earle bulwer-lyttoninternational olympic committeehydrangea macrophylla hortensislydia kamekeha paki liliuokalanipresident william henry harrisonultrasonic pulse velocity tester
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (16)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligencebalance of international paymentspolymonium caeruleum van-bruntiaecalymmatobacterium granulomatis
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (9)
digital communications technologyrevolutionary proletarian nucleusdiego rodriguez de silva y velazquezprimary subtractive color for lightrichard august carl emil erlenmeyerinternational intelligence agencymarine corps intelligence activityovulation method of family planningmary godwin wollstonecraft shelleyPhrases (10)
lycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavaright to speedy and public trial by jurymercury-in-glass clinical thermometerhighly active antiretroviral therapyinternational law enforcement agencycapital: critique of political economysubacute inclusion body encephalitisunited states intelligence communityphysiological jaundice of the newbornPhrases (7)
first epistle of paul the apostle to timothyuniversity of north carolina at chapel hillgenerally accepted accounting principlestrivalent live oral poliomyelitis vaccineu.s. army criminal investigation laboratoryus army criminal investigation laboratoryunited states national library of medicinePhrases (1)
enzyme-linked-immunosorbent serologic assay
