Words Containing: E,L,I,T,Y
(In Any Order)
There are 4,626 words,
3,334 phrases and
0 abbr's with
E,L,I,T,Y in.
Best Scoring Words With: E,L,I,T,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
quietly | 7 | 19 | adverbadv | |||||
adverb • with low volume • with little or no sound • with little or no activity or no agitation (`quiet' is a nonstandard variant for `quietly') • in a restful manner | ||||||||
stylize | 7 | 19 | verbv | |||||
verb • represent according to a conventional style | ||||||||
zestily | 7 | 19 | adverb, adjectiveadv, adj | |||||
adverb • with zest | ||||||||
lekythi | 7 | 17 | nounn | |||||
Valid word for Scrabble US
| ||||||||
whitely | 7 | 16 | ||||||
Valid word for Scrabble US
| ||||||||
heftily | 7 | 16 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
techily | 7 | 15 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
ethylic | 7 | 15 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
lecythi | 7 | 15 | nounn | |||||
Valid word for Scrabble US
| ||||||||
emptily | 7 | 14 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (46)
realityquietlylibertywhitelyemptilystylizeiratelytiredlyineptlytestilyzestilytepidlysylvitelithelytechilyfetidlystyliteinertlyheftilyvilayettearilyethyliclydditeflytiertoylikehyalitemeatilystylisetritelylitterypettilylecythieyeliftlekythiethinyl
...View all with 7 letters...
Phrases (1)
in styleWords (151)
directlyentirelyterriblysilentlyliterarypolitelyequalityvelocityfidelityfelicitysteadilyplaytimeactivelybitterlyheartilytricycleuntimelypriestlyliteracydimethyllegalityintentlyyuletidesenilitystylizedblithelyvenalitysisterlyglitteryminutelyprettilytoiletryinnatelystylisedkilobyte
...View all with 8 letters...
Phrases (4)
ptolemy ilent lilytim learycity lineWords (258)
certainlyliterallycelebritylifestylespecialtysexualityartilleryprivatelyevidentlymentalityhairstylefertilityviolentlyfairytalepatientlyintenselylongevityroutinelyexcitedlyethicallysterilitystorylinehealthilytediouslygentilitysolemnityeminentlycredulityelectrifydefiantlyinterplaypointedlywealthilyfurtivelypainterly
...View all with 9 letters...
Phrases (17)
high stylehair stylelife storytea familywild thymelittle yustiger lilyemily postwhite lilywiley post
...View all with 9 letters...
Words (379)
definitelyultimatelyhystericalrelativelypositivelyinevitablyspecialitycomplexityinfidelitydiscreetlyrelativityinfinitelyinternallyintimatelyindirectlysensualityinherentlyverticallymistakenlyadmittedlyterminallyexplicitlynegativelystealthilydelicatelycreativelyinnocentlydiligentlyneutralitytirelesslylegitimacyinequalityostensiblyelasticitydiscretely
...View all with 10 letters...
Phrases (35)
line of dutymt. mckinleyrift valleylist systemeaster lilybasil thymesafety islewalt disneysilver citypuebla city
...View all with 10 letters...
Words (621)
immediatelyelectricitypersonalitydifferentlytechnicallyessentiallybeautifullyemotionallytemporarilypotentiallycredibilitygeneticallyeffectivelymomentarilyflexibilitysymmetricalefficientlyobjectivelysensibilityterminologyincessantlyconfidentlyextensivelyreliabilityincorrectlypolytechnicattentivelyimpatientlyinfertilityeventualityexquisitelycrystallineeligibilityselectivelyerratically
...View all with 11 letters...
Phrases (79)
laying wastesingle entryfilthy lucrelike royaltybicycle seatmystic jewelbilly the kidemily bronteclosely knitcelery stick
...View all with 11 letters...
Words (757)
accidentallydeliberatelyincidentallyevolutionaryindefinitelypassionatelysufficientlymysteriouslygynecologistconsistentlyhypotheticaldefinitivelycollectivelyconvenientlymetaphysicalstorytellinghystericallymeticulouslytechnicalityfigurativelytriglyceridedelightfullypatheticallycrystallizedasymmetricalrespectivelylegitimatelyelectrifyingincoherentlydomesticallyelectricallypersistentlydesirabilitytheophyllineunilaterally
...View all with 12 letters...
Phrases (106)
molly pitcherlickety splitmyrtle familyathletic typephantasy lifematerial bodytreasury billlienal arterytennis playerpetit larceny
...View all with 12 letters...
Words (786)
revolutionaryapproximatelyintentionallytheoreticallyhomosexualityexceptionallyindependentlyinstinctivelyvulnerabilityinterestinglyappropriatelycomplimentaryparliamentaryinadvertentlygynaecologistrealisticallystrategicallypredominantlyexponentiallycategoricallyintelligentlyfrighteninglycomparativelyirretrievablymagnificentlyalternativelynitroglycerineverlastinglystereotypicalconsecutivelybelievabilitybiotechnologyaestheticallyimperceptiblyintravenously
...View all with 13 letters...
Phrases (155)
aleatory musicvaginal arterygilbert murraymount mckinleyadmiralty mileacrylate resinbilly mitchellheavy particlegenus dactylislillie langtry
...View all with 13 letters...
Words (613)
responsibilitysimultaneouslyscientificallyhypotheticallysystematicallyintellectuallycoincidentallymetaphoricallyaffectionatelyelectronicallydemocraticallysentimentalitymathematicallyrespectabilityalphabeticallyunquestionablyintentionalityinterplanetaryconfidentiallyterritorialityhyperventilatenitroglycerineexcruciatinglyintermittentlyconservativelyconventionallypredictabilityclitoridectomysusceptibilityexperimentallymetaphysicallytelepathicallyreproductivelydiscourteouslydimensionality
...View all with 14 letters...
Phrases (215)
field intensitywilliam tyndaledimethyl ketonehigh technologysabbatical yearadmiralty metalcapital of kenyavisual propertyfamily turdidaeoriental cherry
...View all with 14 letters...
Words (479)
confidentialityextraordinarilyinternationallytechnologicallyunintentionallyinstantaneouslyenvironmentallyinappropriatelyanaesthesiologydisrespectfullyheterosexualityconscientiouslysynergisticallyinaccessibilityintellectualitysurreptitiouslyparentheticallyplenipotentiaryproportionatelymaneuverabilitytherapeuticallyinfinitesimallyinstrumentalityinvulnerabilitycontroversiallycytomegaloviruscompassionatelyuncomplimentarymethylphenidaterecrystallizingpostoperativelyintrospectivelyunparliamentaryuninterruptedlyunacceptability
...View all with 15 letters...
Phrases (283)
auditory ossiclebenefit of clergyalimentary pastefamily tinamidaeby trial and errorfamily artamidaepsychotic beliefwassily leontiefsolemnity of marystonecrop family
...View all with 15 letters...
Words (202)
enthusiasticallyindiscriminatelyirresponsibilitytriphenylmethanehyperintelligentunpredictabilityhyperventilationquintessentiallyphylogeneticallyimperceptibilitynonrevolutionarypharmaceuticallyerythroblastosisunapologeticallythermostaticallysurrealisticallyincontrovertiblyelectrochemistryinconceivabilityconversationallypolydispersitieshypersalivationsinextinguishablycolorimetricallyexterritorialitythermometricallyparamagneticallytrinitroglycerincommensurabilitynoncompetitivelyhypersexualitiespolyphyleticallyinexhaustibilitythermoplasticityunostentatiously
...View all with 16 letters...
Phrases (288)
in a beastly manneritalian greyhoundstrictly speakingin an elaborate wayvariable quantityfamily locustidaerelative majoritynevil shute norwaycommercial treatymechanical system
...View all with 16 letters...
Words (137)
unconventionalitybacteriologicallymaterialisticallyneurophysiologistelectrostaticallythermodynamicallyinconsequentiallyinterdisciplinaryantirevolutionaryself-contradictoryisoelectronicallyunexchangeabilityspondylolisthesishyperstimulationsspectroscopicallyhyperventilationshypnotizabilitieschlortetracyclinemonosyllabicitiespaternalisticallypathophysiologiesarchitectonicallyferrimagneticallymorphogeneticallyunderstandabilitycryptocrystallineencephalomyelitiscrystallographiespostrevolutionarymicropaleontologydisrespectabilitylymphadenopathieshyperalimentationcytomegalovirusescounterfactuality
...View all with 17 letters...
Phrases (314)
mary leontyne pricebalaena mysticetusproteolytic enzymehypoglycemic agentpearly everlastingtheological systemcapital of kentuckycylinder separatorexecutive clemencyfamily trochilidae
...View all with 17 letters...
Words (67)
characteristicallydisproportionatelyinconsequentialityhypercoagulabilityhyperaldosteronisminterchangeabilitypolyesterificationspectroheliographypolyribonucleotidecylindrical-stemmedstereospecificallyimmunocytochemicalcalymmatobacteriumstoichiometricallydiethylmalonylurearecrystallizationsdiethylstilbestrolcounterintuitivelyhypercholesteremiamagnetostrictivelymyeloproliferativehydroflumethiazidedehydrochlorinateddehydrochlorinatestrichloroethylenesgranulocytopoiesesspectrographicallygranulocytopoiesispolypropenonitrileneurophysiologistsrepresentationallyelectromyographiesultracentrifugallyneuropsychologistsmetallographically
...View all with 18 letters...
Phrases (307)
revolutionary groupfamily physeteridaedame sybil thorndikelachrymal secretionnavigational systemcolumbia universityclass schizomycetesfamily trichechidaesuperiority complexcommercial activity
...View all with 18 letters...
Words (62)
hydrochlorothiazidecinematographicallypolyesterificationsextralinguisticallypolyribonucleotidesextraterritorialityhypersusceptibilityhypolipoproteinemiaparthenogeneticallynonrelativisticallyconceptualisticallydiethylstilbesteroldiethylstilboestrolbacteriochlorophyllphenomenalisticallyphenylthiocarbamidedehydrochlorinatingdehydrochlorinationphosphatidylcholineinterconvertibilityinterdepartmentallyelectromagneticallycontradistinctivelyelectromechanicallythird-dimensionalityinterferometricallyhysterosalpingogramthree-dimensionalityimpressionisticallyelectrophoreticallymethylprednisoloneselectrophysiologieselectrophysiologistdeoxyribonucleotideanthropocentrically
...View all with 19 letters...
Phrases (303)
water-plantain familyacetylsalicylic acidfamily cyclopteridaejohn millington syngeitalian monetary unitlatvian monetary unitmillimeter of mercuryalpine type of glaciergiles lytton stracheyphytolacca americana
...View all with 19 letters...
Words (31)
counterrevolutionaryuncharacteristicallyhypercholesterolemiaoverenthusiasticallytetrahydrocannabinolpolyphiloprogenitiveimmunocytochemicallymagnetofluiddynamicsbacteriochlorophyllsphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesneuropsychiatricallyhyperlipoproteinemiaelectrophysiologicalelectrophysiologistsdeoxyribonucleotidesmicrocrystallinitiesroentgenographicallyencephalomyocarditischemotherapeuticallyhydrochlorothiazidesmicrophotometricallysyncategorematicallyhypercholesterolemichypercoagulabilitiesdimethylnitrosaminesplethysmographicallyexistentialisticallyPhrases (258)
william stanley jevonsyellow-shafted flickerwyethia amplexicaulisorder mycelia steriliafamily phytolaccaceaemalawian monetary unitlebanese monetary unitorder myxobacterialesfamily trachipteridaebalance sheet analysis
...View all with 20 letters...
Words (10)
hypersusceptibilitiesstereomicroscopicallyacetylcholinesterasesotorhinolaryngologieselectromyographicallyintersubstitutabilityantiferromagneticallyhypercholesterolemiaspsychotherapeuticallytetrahydrocannabinolsPhrases (203)
icelandic monetary unitelectrolytic condenseraleksandr solzhenitsynmalaysian monetary unithelichrysum bracteatumbulgarian monetary unitsri lankan monetary uniteucalyptus fraxinoidesisle royal national parkcapital of pennsylvania
...View all with 21 letters...
Words (5)
spectrophotometricallyintercomprehensibilityelectrophysiologicallyhexamethylenetetramineencephalomyocarditisesPhrases (197)
venezuelan monetary unitlycopersicon esculentumhaliaeetus leucorhyphusredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynfamily dendrocolaptidaemultiple mononeuropathyloyalist volunteer force
...View all with 22 letters...
Words (2)
hexamethylenetetramineshypobetalipoproteinemiaPhrases (121)
family threskiornithidaeposterior pituitary glandyellowstone national parkcalycanthus occidentalisinterlocutory injunctionbangladeshi monetary unitdorothy rothschild parkersciadopitys verticillatatricyclic antidepressantmcguffey eclectic readers
...View all with 23 letters...
Words (5)
laryngotracheobronchitishyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolaminemicroelectrophoreticallyPhrases (81)
carnegie mellon universitylouis seymour bazett leakeymary wollstonecraft godwinunidentified flying objectprivately held corporationbrassica oleracea botrytisdistinguished flying crossfluoxetine hydrocholorideexistentialist philosophytechnology administration
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (74)
francis scott key fitzgeraldcentral intelligence agencyedmund john millington syngepolystichum acrostichoidesreligious society of friendscaulophyllum thalictroidestrans-alaska pipeline systempyotr alexeyevich kropotkinsir arthur stanley eddingtonmichelson-morley experiment
...View all with 25 letters...
Phrases (51)
employee stock ownership planevelyn arthur saint john waughcharles maurice de talleyrandrevolutionary calendar monthbureau of diplomatic securityentandrophragma cylindricumbenign prostatic hyperplasiapalestine national authoritymyrtillocactus geometrizansair force research laboratory
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (43)
business environment analysisamerican revolutionary leaderaugustus welby northmore puginco-operative republic of guyanacommissioned military officernuclear regulatory commissiontricyclic antidepressant drugjames augustine aloysius joycethyrotropin-releasing hormonecryptobranchus alleganiensis
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (39)
revolutionary people's struggletriphosphopyridine nucleotideoxytetracycline hydrochloridefyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationfeodor mikhailovich dostoevskydepartment of homeland securitymaster of arts in library sciencedissident irish republican army
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (26)
business environmental analysisacrylonitrile-butadiene-styreneantisocial personality disorderscrutin uninominal voting systeminternational olympic committeemiddle east respiratory syndromehydrangea macrophylla hortensispresident william henry harrisonultrasonic pulse velocity testernational intelligence community
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (28)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligencedepository financial institutionethylenediaminetetraacetic acidbalance of international payments
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (16)
great smoky mountains national parkfreedom from involuntary servitudedigital communications technologytupac amaru revolutionary movementrevolutionary proletarian nucleusprimary subtractive color for lightrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyerinternational atomic energy agencymarie anne charlotte corday d'armont
...View all with 31 letters...
Phrases (15)
hierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationsodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory druguniversity of california at berkeleyprimary subtractive colour for lighttheory of electrolytic dissociationlymphocytic choriomeningitis virus
...View all with 32 letters...
Phrases (14)
lycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human serviceshighly active antiretroviral therapyinternational law enforcement agency
...View all with 33 letters...
Phrases (9)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesmassachusetts institute of technologyeinstein's general theory of relativityeinstein's special theory of relativitycomputerized axial tomography scannerrevolutionary armed forces of colombiaPhrases (10)
communications security establishmentrevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence serviceimmaculate conception of the virgin marynational socialist german workers' partyfraxinus pennsylvanica subintegerrimasecurity intelligence review committeeunited states naval research laboratoryPhrases (9)
first epistle of paul the apostle to timothyuniversity of north carolina at chapel hillgenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratoryus army criminal investigation laboratorysixteen personality factor questionnaireunited states national library of medicinePhrases (1)
enzyme-linked-immunosorbent serologic assay