Words Containing: E,K,L,R,Y
(In Any Order)
There are 185 words,
386 phrases and
0 abbr's with
E,K,L,R,Y in.
Best Scoring Words With: E,K,L,R,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| jerkily | 7 | 21 | adverb, adjectiveadv, adj | |||||
adverb • with spasms • with jerking motions | ||||||||
| freckly | 7 | 19 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| perkily | 7 | 16 | adverb, adjectiveadv, adj | |||||
adverb • in a perky manner | ||||||||
| clerkly | 7 | 16 | adverb, adjectiveadv, adj | |||||
adjective • Of clerks; befitting a clerk. • Scholarly. adverb • In a scholarly manner. | ||||||||
| raylike | 7 | 14 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| yolkier | 7 | 14 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (41)
drunkenlykimberleyjaywalkerplaymakerhyperlinkcrookedlyberrylikefairylikesyruplikeskylarkerirksomelywalkyriesberserklyyarmelkesyarmulkeskaleyardsrakehellyjerkinglystreakilymalarkeysivorylikeharpylikeskylarkedkerflooeykryolitestriweeklyvalkyriessatyrlikescreakilyblack-greykeyloggerflymakersklondykerrevokablyflystrike
...View all with 9 letters...
Phrases (9)
like crazyturkey legkeep relaylayer cakemyrtle oakrelay linklyre snakepork bellypork jellyWords (32)
remarkablyblackberrybricklayerrecklesslyfreakishlylawyerlikelukewarmlycocksurelyskylarkersplaymakershyperlinksperikaryalcherrylikejaywalkerstracklayerkeyloggersmarketablyklondykersflystrikesbaby-walkercreakinglyyellowbarkstrokeplaylooyenworkcankeredlykaryolysesstrickenlyrebukinglyunbrokenlyforsakenlyparakeelyapokerishlyPhrases (16)
mary leakeytalk turkeylady killergrace kellygrey jackalalkyd resincontrol keytally clerkstroke playkoto player
...View all with 10 letters...
Words (24)
huckleberryskulduggeryhyperlinkedbricklayersalkalimetryfactorylikelickerishlytracklayerskaryologiesfarkleberrykleptocracyskuldudderycackleberryself-mockeryshriekinglyyellowbarkslooyenworksfernytickletracklesslyrebukefullybialystokersparklesslysilky-hairedparakeelyasPhrases (17)
like royaltypolicy makermackerel skycelery stickleon trotskybicycle rackkitty litterblack cherryplain turkeyhooky player
...View all with 11 letters...
Words (23)
skullduggeryhyperkalemiaholidaymakerhyperlinkingflickeringlyunremarkablydaydreamlikekremlinologykeratoplastyyellow-markedrevokabilityfairnytickleblackish-greygreyish-blackunprovokedlyfernyticklessparkleberrydusky-coloredhydraulickedbreakabilitylocksmitheryquicksilverykeratohyalinPhrases (21)
alben barkleyalfred kinseyliterary workjewelry makerhockey playercylinder lockvery much likeslippery dickmercy killingreality check
...View all with 12 letters...
Words (15)
marketabilityholidaymakersphytoplankterkindheartedlyhe-huckleberryblackberryingfairnyticklesjawbreakinglyremarkabilityheartbrokenlydusky-colouredpoikilothermyforeknowinglyprickly-leafedprickly-leavedPhrases (25)
el iskandriyahnorfolk wherryrichard leakeyblack mulberrysilky wisteriakillarney ferncylinder blocklaundry basketturkey vulturekeyboard shelf
...View all with 13 letters...
Words (11)
leukodystrophyphytoplanktersankylosaurusesbreathtakinglyearthshakinglycantankerouslyhydrokineticalblackberry-lilyblackberryingshuckleberryingyekaterinoslavPhrases (30)
drunken revelryveliky novgorodblackberry bushold world monkeykyrgyz republicbishop berkeleyblack raspberryfamily akeridaestanley kubrickrockrose family
...View all with 14 letters...
Phrases (1)
technical analysis of stock trendsPhrases (1)
great smoky mountains national parkPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay
