Words Containing: E,K,E,Y
(In Any Order)
There are 341 words,
636 phrases and
0 abbr's with
E,K,E,Y in.
Best Scoring Words With: E,K,E,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
cheeky | 6 | 18 | adjectiveadj | |||||
adjective satellite • offensively bold | ||||||||
weekday | 7 | 18 | nounn | |||||
noun • any day except Sunday (and sometimes except Saturday) | ||||||||
buckeye | 7 | 18 | nounn | |||||
noun • a native or resident of Ohio • the inedible nutlike seed of the horse chestnut • tree having palmate leaves and large clusters of white to red flowers followed by brown shiny inedible seeds | ||||||||
dovekey | 7 | 18 | nounn | |||||
Valid word for Scrabble US
| ||||||||
keyhole | 7 | 17 | nounn | |||||
noun • the hole where a key is inserted | ||||||||
eyehook | 7 | 17 | nounn | |||||
Valid word for Scrabble US
| ||||||||
eyewink | 7 | 17 | verb, nounv, n | |||||
Valid word for Scrabble US
| ||||||||
weekly | 6 | 16 | adverb, adjectiveadv, adj | |||||
noun • a periodical that is published every week (or 52 issues per year) adverb • without missing a week adjective satellite • of or occurring every seven days | ||||||||
sockeye | 7 | 16 | verb, noun, adjectivev, n, adj | |||||
noun • fatty red flesh of salmon of Pacific coast and rivers • small salmon with red flesh; found in rivers and tributaries of the northern Pacific and valued as food; adults die after spawning | ||||||||
pinkeye | 7 | 16 | nounn | |||||
noun • inflammation of the conjunctiva of the eye | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (55)
berkeleyweekdayskeystonekennellycockeyedkerenskyjockeyedbiweeklymonkeyedcheekilykeffiyehkeynotedkeynoteryokelesshawkeyedeyehookseyewinkscockeyeskeyholeskeynoteslackeyedkeystersrekeyingyarmelkewheylikeokeydokeyokemateeyeblackeyeblinkkernellysockeyesbuckeyeseyestalkdovekeyspinkeyes
...View all with 8 letters...
Phrases (10)
eye blinkken keseyholy weekscrew keykeep awaygreek keyblack eyeallen keynaked eyelake eyreWords (43)
speakeasykimberleykeynesianhackneyedkeystrokeleukocytejellylikeeukaryoteberrylikekeynoterskeffiyehsberserklyyarmelkesrakehellykeystonesokeydokeyyeastlikeyokemateskerflooeyeyeblackseyeblinkseuryokiestriweeklymakereadybellylikehokeynesseyestalkspokeberrymidweeklykeybugleskeyloggergreywackekeystonedlykewakeshoneylike
...View all with 9 letters...
Phrases (25)
every weekturkey legturkey redkey strokekeep relayreturn keyeye socketlayer cakeduke waynehoney cake
...View all with 9 letters...
Words (49)
recklesslymoneymakerpernicketylawyerlikemerrymakerkeypuncheskeystrokedyokefellowskeletallychokeberrykeyboardedcockeyedlykeypunchedkeypuncherkeystrokesrekeyboardleukocytesflyspeckedsemiweeklyfecklesslycherrylikekerseymerenewsweeklyhokeypokeyeukaryoteskeyboarderhenpeckeryperjinketykidneyliketewkesburyyellowcakekeyloggerspyknometergreywackescrakeberry
...View all with 10 letters...
Phrases (30)
mary leakeykey patternisle of skyegreek deityhook and eyegrace kellytake it easykidney fernchunky heelhockey game
...View all with 10 letters...
Words (54)
hypermarkethuckleberryhoneysuckleyellowknifepersnicketymonkeyshinechokecherryyevtushenkohyperlinkedyokefellowsskyrocketedbodycheckedhokeynesseschimneylikeoutjockeyedcytokinesesmoneymakerskeypuncherscockneyfiedcockneyfiesrekeyboardsyuckinessesunhackneyedmerrymakerskerseymereshokeypokeysfarkleberrykeyboarderspyknometersteknonymieswhiskeyfiedready-cookedsnakeblennyhoneysuckercackleberry
...View all with 11 letters...
Phrases (39)
louis leakeymackerel skykeep an eye onemmett kellycelery stickannie oakleywhiskey neattake-home payfield hockeyjourney cake
...View all with 11 letters...
Words (36)
hyperkalemiahyperkineticcheckerberryhyperkineseshyperkinesiaheterokaryonhoneysucklesmonkeyshinescytoskeletoncockeyednesscytoskeletalhyperkinesisrekeyboardedhypermarketsleukocytosesdaydreamlikekaryokinesesyellow-markedstickybeakedhoneysuckershoneysuckledyankee-doodlealkylbenzenecockyleekieskeynesianismkeratophyrespennywinklesalkalescencyladylikenessfernyticklessparkleberrymusky-scentedcrackerberrypancake-stylemonkey-wrench
...View all with 12 letters...
Phrases (51)
backspace keyhockey leaguerisky venturealben barkleybuckeye staterhesus monkeyblink of an eyealfred kinseyhawkeye stateyellow jacket
...View all with 12 letters...
Words (18)
cytoskeletonsknowledgeablyrekeyboardingmountebankeryhyperkinesiasheterokaryonsmegakaryocytepsychokineseskindheartedlyhe-huckleberrykitty-corneredblockheadedlyheartbrokenlykenyapithecusjiggery-pokerykinesitherapyprickly-leafedprickly-leavedPhrases (47)
robert m. yerkesjekyll and hydethree kings' dayrichard leakeychesapeake baywhiskey bottletank destroyerkillarney ferngenus kennedyablended whisky
...View all with 13 letters...
Words (15)
hyperkeratoticcockeyednesseshyperkeratoseshyperkeratosisheterokaryosesheterokaryosisheterokaryoticacknowledgedlymegakaryocytesleukocytosisesvelvety-skinnedhuckleberryingyekaterinoslavladylikenessesdiphenylketonePhrases (49)
dimethyl ketonedrunken revelryemergency brakeskeletal systemblended whiskeydynamic speakerkeynote addresshenry kissingerbishop berkeleysleepy sickness
...View all with 14 letters...
Words (11)
heartbreakinglykinestheticallyphenylketonurictelekineticallyphenylketonuriabrokenheartedlykenogeneticallypoverty-strickenacknowledgeablyhuckleberryingsdiphenylketonesPhrases (45)
erlenmeyer flaskkeep one's eyes offsecurity blanketmonkey-bread treemarketable yieldgenus myxinikelafield hockey ballocellated turkeysprinkler systempinckneya pubens
...View all with 15 letters...
Words (8)
heterokontophytaleukodystrophieskinaestheticallyphenylketonuriasphenylketonuricsheterokaryosiseskrypterophaneronknowledgeabilityPhrases (43)
friendly takeoverfamily gekkonidaeelwyn brooks whitefeodor dostoevskytrackless trolleycreek confederacycoral honeysucklepresident kennedyyellowfin croakersnowy tree cricket
...View all with 16 letters...
Words (1)
alkylbenzenesulfonatePhrases (24)
aleksandr solzhenitsynsoren aabye kierkegaardjohn fitzgerald kennedythomas kennerly wolfe jr.sir john cowdery kendrewpresident john f. kennedyschlumbergera buckleyimusculoskeletal systemthin-leaved stringybarkketamine hydrochloride
...View all with 21 letters...
Phrases (15)
francis scott key fitzgeraldmodest petrovich mussorgskytrans-alaska pipeline systempyotr alexeyevich kropotkinandrei arsenevich tarkovskymelville louis kossuth deweypodkamennaya tunguska riveraleksey maksimovich peshkovmikhail yurievich lermontovchamaecyparis nootkatensis
...View all with 25 letters...
Phrases (1)
technical analysis of stock trendsPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay