Words Containing: E,I,N,E,Y
(In Any Order)
There are 2,065 words,
2,847 phrases and
0 abbr's with
E,I,N,E,Y in.
Best Scoring Words With: E,I,N,E,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
eyewink | 7 | 17 | verb, nounv, n | |||||
Valid word for Scrabble US
| ||||||||
pinkeye | 7 | 16 | nounn | |||||
noun • inflammation of the conjunctiva of the eye | ||||||||
hygiene | 7 | 14 | nounn | |||||
noun • a condition promoting sanitary practices • the science concerned with the prevention of illness and maintenance of health | ||||||||
hyenine | 7 | 13 | ||||||
Valid word for Scrabble US
| ||||||||
myeline | 7 | 12 | ||||||
noun • a white fatty substance that forms a medullary sheath around the axis cylinder of some nerve fibers | ||||||||
needily | 7 | 11 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
eyeing | 6 | 10 | verb, adjectivev, adj | |||||
noun • the organ of sight • good discernment (either visually or as if visually) • attention to what is seen • an area that is approximately central within some larger region • a small hole or loop (as in a needle) verb • look at | ||||||||
syenite | 7 | 10 | noun, adjectiven, adj | |||||
noun • Granite. • An igneous rock composed of feldspar and hornblende. | ||||||||
yeelins | 7 | 10 | ||||||
Valid word for Scrabble US
| ||||||||
yeelin | 6 | 9 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (36)
entirelyeternityserenityeyelinerrefineryentiretyleniencyeminencyexigencyredyeingfelinelysyenitescysteineeyewinkssenilelyequinelyrekeyingengineryeyeblinkmyelineslienteryeyepointgingeleyeyeshineberylinepinkeyeshygieneskeylinesreneyingmytileneayenbitebedyeingjeelyingdyelinesqueynies
...View all with 8 letters...
Phrases (2)
eye blinkmind's eyeWords (109)
sincerelyevidentlynecessitygenuinelyseeminglyintenselyimmenselyresidencyindecencyglycerinekeynesianeminentlyeyestraininverselyfeelinglyremedyingpensivelylenientlyjeeringlyoxygenizeinebrietyweepinglyexigentlyethylenicesuriencyrenitencyfeignedlyreticencysyngeneiccysteinesteeminglyleeringlyshinneyedveeringlytepefying
...View all with 9 letters...
Phrases (12)
queen cityriver tynetyne riverevery inchde quinceynellie blypineal eyeeye clinicpenis envydelay line
...View all with 9 letters...
Words (190)
everythingdefinitelygenerosityefficiencyeyewitnesspresidencydeficiencyveterinaryinherentlynegativelycyberneticsynthesizeindecentlyepicondyleobedientlysynthesiseresiliencyexpediencypernicketyinexpertlyoxygenizedeffeminacyfleetinglygeneralitysneeringlydesignedlysynaeresisinclemencysyncretisemyelinatedsyncretizesynergeticpenitentlydivergencypertinency
...View all with 10 letters...
Phrases (28)
epoxy resinenergy unitaniline dyeyemeni rialnorse deitykidney fernsidney webbin a pig's eyein any eventhoney guide
...View all with 10 letters...
Words (301)
differentlynecessarilyessentiallygeneticallysovereigntybeneficiaryexceedinglyefficientlysynthesizerdelinquencyextensivelyattentivelyeventualityserendipityevidentiarysedimentaryequivalencydeliverymanintensivelysynesthesiainteragencysynthesizeddefensivelyoffensivelyyellowknifepersnicketyirrelevancyexpedientlyexpensivelytentativelymonkeyshinepennyweightdeservinglysensitivelymethylamine
...View all with 11 letters...
Phrases (39)
genus myxineelinor wyliesingle entryaeolian lyreemily brontecypress vinecurly endiveopen societyhenry millereternal city
...View all with 11 letters...
Words (310)
unbelievablyindefinitelypenitentiaryencyclopediadefinitivelyconvenientlyintermediaryhypertensionelectrifyingpresbyterianincoherentlypersistentlyrefreshinglytheophyllinehypertensiveeccentricityinadequatelyinefficiencybelligerencyphylogeneticinfrequentlystereotypingevidentiallybeneficiallyeffeminatelydepressinglyencyclopedicsequentiallytetracyclineindelicatelyrecessionaryindiscreetlyhyperkineticexemplifyingceremonially
...View all with 12 letters...
Phrases (79)
genus glycineread-only filechinese deitylienal arteryyenisey riverrisky venturetennis playernew jerseyitein perpetuitypetit larceny
...View all with 12 letters...
Words (310)
unnecessarilyexceptionallyindependentlyinterestinglyinadvertentlyexponentiallyintelligentlyalternativelyeverlastinglyconsecutivelyexpeditionaryconfectioneryencyclopaediaindifferentlyenergeticallydependabilitypredominatelyeccentricallysentimentallydeoxygenationinsensitivelyincompetentlyineffectuallyinefficientlyexistentiallyceremoniouslyinexpensivelyunrelentinglymeaninglesslyacetylcholineinexpressiblyimpertinentlyindeterminacyoverbearinglypretentiously
...View all with 13 letters...
Phrases (133)
auditory senseinventory itemspiny anteatercooley's anemiaacrylate resinradiant energyjapanese deityyes-no questiongenus erysimumthree kings' day
...View all with 13 letters...
Words (309)
intellectuallyaffectionatelyelectronicallyoverwhelminglysentimentalityhypersensitivecytogeneticistinterplanetaryhyperventilatenitroglycerineintermittentlyconservativelychemosynthesisexperimentallyinconvenientlyappendicectomyintermediatelyentertaininglydifferentiallypyelonephritisinterferometrymysteriousnesstelephonicallypreferentiallychemosyntheticanesthesiologyextortionatelyoverpoweringlycyproheptadineineffectualityabsentmindedlycomprehensiblydiscontentedlydepolymerizingdenumerability
...View all with 14 letters...
Phrases (143)
field intensitymoonseed familydimethyl ketonecooley's anaemiablended whiskeydrainage systemchinese parsleyoriental cherryoyster dressinglife expectancy
...View all with 14 letters...
Words (220)
environmentallyanaesthesiologyintellectualityparentheticallyplenipotentiarycondescendinglymaneuverabilitymethylphenidatephotosynthesizeintrospectivelyuninterruptedlydemonstrativelyunceremoniouslyheartbreakinglyinconsideratelycomprehensivelydiphenhydramineinterdependencyinterrogativelysymmetricalnessperpendicularlyoxytetracyclinekinestheticallyhypersensitizedcentrosymmetricinteruniversitysemidocumentarycontemplativelycomplementaritymethylxanthinesserendipitouslyunintelligentlynonbelligerencydishearteninglyelectroanalysis
...View all with 15 letters...
Phrases (217)
stay of executionbenefit of clergyalimentary pastehelen wills moodyfamily lemnaceaewassily leontiefspiny-headed wormpipeline companytietze's syndromeamebic dysentery
...View all with 15 letters...
Words (88)
incomprehensiblytriphenylmethanehyperintelligenthyperventilationquintessentiallyphylogeneticallyhypersensitivityhypersensitizingnoncompetitivelyantiunemploymenthyperventilatinghypervitaminosesperpendicularitycryopreservationlyginopteridalesstereophonicallycyclohexylaminesoxyphencycliminekinaestheticallycytotechnologiesunrespectabilityoligodendrocytesconsequentialitymysteriousnessesphenylethylaminephenylketonuriasphenylketonuricsgeneralizabilityneurasthenicallysyncategorematicsemitransparencyorthogeneticallydehydrogenationsmechanochemistryactinomycetaceae
...View all with 16 letters...
Phrases (243)
hypodermic needletympanic membranein a beastly mannerdefinite quantityin an elaborate wayefficiency expertamerican sycamorecommercial agencyfamily balaenidaenevil shute norway
...View all with 16 letters...
Words (57)
counterinsurgencyinconsequentiallyisoelectronicallyunexchangeabilityhyperventilationschlortetracyclineferrimagneticallymorphogeneticallycryopreservationsencephalomyelitislymphadenopathieshyperalimentationtrichloroethyleneimmunogeneticallyelectronegativitythiodiphenylaminephenylethylamineselectroanalyticalnephelometricallydehydrochlorinasesamoyedic-speakingdehydrochlorinatetriphenylmethaneshyperintelligenceaerothermodynamicneurophysiologiesneuropsychiatriesneuropsychologiescomprehensibilitydeoxyribonucleasepetromyzoniformeshyperpigmentationretroperitoneallymicrodensitometrydepolymerizations
...View all with 17 letters...
Phrases (276)
mary leontyne pricebalaena mysticetusczech monetary unitproteolytic enzymehypoglycemic agentinterstate highwaypearly everlastingcylinder separatorexecutive clemencycaesarian delivery
...View all with 17 letters...
Words (44)
inconsequentialityhyperaldosteronisminterchangeabilityhypersensitivenesspolyesterificationhypersensitivitieshypersensitizationpolyribonucleotidenoncomprehensivelysphygmomanometriescylindrical-stemmedhyperbilirubinemiadiethylmalonylureacounterintuitivelymagnetostrictivelyphenomenologicallydehydrochlorinasesdehydrochlorinateddehydrochlorinatesneuroendocrinologytrichloroethylenesgranulocytopoiesespolypropenonitrileaerothermodynamicsrepresentationallymethylprednisolonedeoxyribonucleasesroentgenologicallychlortetracyclinessedimentologicallysemiconservativelydiethylcarbamazinehyperalimentationssemiprofessionallysemiquantitatively
...View all with 18 letters...
Phrases (274)
dame sybil thorndikelachrymal secretionread-only memory chipkilocycle per secondfulminate of mercurygenus chamaecytisusfamily loranthaceaeyemeni monetary unitvictory celebrationfamily magnoliaceae
...View all with 18 letters...
Words (32)
polyesterificationshypersensitizationspolyribonucleotideshypolipoproteinemiaparthenogeneticallycytodifferentiationcytopathogenicitiesphenomenalisticallyphenylthiocarbamidemercury-contaminatedinterconvertibilityinterdepartmentallyelectromagneticallyelectromechanicallyinterferometricallythree-dimensionalitymethylprednisolonesdeoxyribonucleotideelectroretinographyincomprehensibilitymicroelectronicallyencephalomyelitidesphenylpropanolaminehydroxytetracyclineoverproportionatelydiethylcarbamazineshyperconcentrationstetramethyldiarsinedimethylnitrosaminehyperemotionalitiesdimethyltryptaminesexpressionisticallyPhrases (258)
alpine type of glaciergiles lytton stracheyzairese monetary unitnancy freeman mitfordchinese monetary unitcost-benefit analysissubfamily mephitinaetheory of inheritanceunix operating systemsecondary censorship
...View all with 19 letters...
Words (17)
counterrevolutionaryoverenthusiasticallyhypersensitivenessespolyphiloprogenitivehyperadrenocorticismcytodifferentiationsphenylpropanolaminesphenylthiocarbamidesacetylcholinesterasehyperlipoproteinemiadeoxyribonucleotidesroentgenographicallyencephalomyocarditissyncategorematicallyhyperconsciousnessesdimethylnitrosaminesexistentialisticallyPhrases (227)
william stanley jevonslebanese monetary unitbalance sheet analysisbyelorussian languagebenjamin henry latrobeuniversity of nebraskamilton snavely hersheymagnetic bubble memoryclassifying adjectivefriendly relationship
...View all with 20 letters...
Words (4)
immunocytochemistriesacetylcholinesterasespolyvinyl-formaldehydeantiferromagneticallyPhrases (160)
icelandic monetary unitelectrolytic condenseraleksandr solzhenitsyndesoxyribonucleic acidextrauterine pregnancybyzantine architecturepseudemys rubriventriseucalyptus fraxinoidesnorwegian monetary unitstrawberry haemangioma
...View all with 21 letters...
Words (4)
intercomprehensibilityhexamethylenetetramineencephalomyocarditisesdihydroxyphenylalaninePhrases (163)
venezuelan monetary unitlycopersicon esculentumredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynfamily dendrocolaptidaemultiple mononeuropathyloyalist volunteer forcehigh-density lipoprotein
...View all with 22 letters...
Words (2)
hexamethylenetetramineshypobetalipoproteinemiaPhrases (104)
family threskiornithidaemeperidine hydrochlorideyellowstone national parkparis-sorbonne universitybangladeshi monetary unitsouth korean monetary unittyrosine kinase inhibitorrichard brinsley sheridantricyclic antidepressantsearch and destroy mission
...View all with 23 letters...
Words (2)
hyperbetalipoproteinemiaphosphatidylethanolaminePhrases (92)
carnegie mellon universityargyroxiphium sandwicensesubdivision deuteromycotadivision heterokontophytaunidentified flying objectprivately held corporationzollinger-ellison syndromesir terence mervyn rattiganalexandre emile jean yersinfluoxetine hydrocholoride
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (78)
myroxylon balsamum pereiraediamond wedding anniversaryfrancis scott key fitzgeraldcentral intelligence agencyedmund john millington syngepropoxyphene hydrochloridereligious society of friendsbeggar-my-neighbour strategytrans-alaska pipeline systempyotr alexeyevich kropotkin
...View all with 25 letters...
Phrases (58)
brassica oleracea gongylodeshunting and gathering societyhuman immunodeficiency virussecretary of veterans affairsemployee stock ownership planevelyn arthur saint john waughassyrian neo-aramaic languagecharles maurice de talleyrandrevolutionary calendar monthnewton's theory of gravitation
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (46)
business environment analysisamerican revolutionary leadernikita sergeyevich khrushchevholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinaugustus welby northmore puginco-operative republic of guyanacommissioned military officernuclear regulatory commission
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (43)
revolutionary people's strugglealeksandr feodorovich kerenskyephippiorhynchus senegalensistriphosphopyridine nucleotideoxytetracycline hydrochloridemarcus junius brutus the youngermicrosoft disk operating systemdepartment of homeland securitymaster of arts in library sciencedissident irish republican army
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (30)
business environmental analysisaleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitinternational olympic committeemiddle east respiratory syndromeunited arab emirate monetary unit
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (28)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligenceethylenediaminetetraacetic acidbalance of international paymentswaterhouse-friderichsen syndrome
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (15)
freedom from involuntary servitude2019-ncov acute respiratory diseasetupac amaru revolutionary movementrevolutionary proletarian nucleusrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyerinternational atomic energy agencymarie anne charlotte corday d'armontinternational intelligence agencyfibrocystic disease of the pancreas
...View all with 31 letters...
Phrases (16)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovuniversity of california at berkeleytheory of electrolytic dissociationyevgeni aleksandrovich yevtushenkotyrannus domenicensis domenicensis
...View all with 32 letters...
Phrases (15)
autonomous sensory meridian responselycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavaright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human serviceshighly active antiretroviral therapyinternational law enforcement agency
...View all with 33 letters...
Phrases (11)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesdryopithecus rudapithecus hungaricusmassachusetts institute of technologyeinstein's general theory of relativityeinstein's special theory of relativitygymnosporangium juniperi-virginianaecomputerized axial tomography scanner
...View all with 34 letters...
Phrases (11)
communications security establishmentrevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence serviceimmaculate conception of the virgin maryhereditary motor and sensory neuropathynational socialist german workers' partyfraxinus pennsylvanica subintegerrimasecurity intelligence review committee
...View all with 35 letters...
Phrases (10)
severe combined immunodeficiency diseaseuniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentacademy of motion picture arts and scienceskarl friedrich hieronymus von munchhausensixteen personality factor questionnaireunited states national library of medicine