Words Containing: E,I,C,H,E
(In Any Order)
There are 3,234 words,
3,735 phrases and
0 abbr's with
E,I,C,H,E in.
Best Scoring Words With: E,I,C,H,E
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| kimchee | 7 | 18 | nounn | |||||
noun • A Korean dish made of vegetables, such as cabbage or radishes, that are salted, seasoned, and stored in sealed containers to undergo lactic acid fermentation. • A Korean person. | ||||||||
| chickee | 7 | 18 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| ceviche | 7 | 17 | noun, adjectiven, adj | |||||
noun • Raw seafood cured by marination in an acidic medium such as citrus, vinegar, or other souring agent, found primarily in Latin America. | ||||||||
| ephebic | 7 | 16 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| chevied | 7 | 16 | verbv | |||||
verb • annoy continually or chronically | ||||||||
| vehicle | 7 | 15 | nounn | |||||
noun • a conveyance that transports people or objects • a medium for the expression or achievement of something • any substance that facilitates the use of a drug or pigment or other material that is mixed with it • any inanimate object (as a towel or money or clothing or dishes or books or toys etc.) that can transmit infectious agents from one person to another | ||||||||
| achieve | 7 | 15 | verbv | |||||
verb • to gain with effort | ||||||||
| fitchee | 7 | 15 | verb, nounv, n | |||||
Valid word for Scrabble US
| ||||||||
| cepheid | 7 | 15 | nounn | |||||
noun • A cepheid variable. adjective • Relating to cepheid variables. | ||||||||
| seviche | 7 | 15 | verb, nounv, n | |||||
noun • Raw seafood cured by marination in an acidic medium such as citrus, vinegar, or other souring agent, found primarily in Latin America. | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (126)
cheeringachieveddecipherkerchieficehousecheeriosachieverchiseledcheshirechenillecohesivechiseleresthetichermeticcheerilyhellenicherpeticcheeriercheekilycheesingencipherdehiscedechinatecheapieslichenedcheepingcipheredenricherkimcheesrichenedtetchierchewiestaethericchelipedachieves
...View all with 8 letters...
Phrases (5)
head liceshelf icegene chipice chestice shelfWords (242)
catherinetechniquewhichevernietzschechevaliercherishedaesthetichelveticabewitchedgreenwichheadpiecehairpiecehereticalpetechialrichelieukitchenerechinaceaschlierenchickadeeshowpieceherbicidethickenedgaucheriecheeriesthegemonicthickenerpetechiaeparcheesischlemieltheoreticchickweedhyperemicspeechifychiselleralchemize
...View all with 9 letters...
Phrases (21)
itchy feetwhite racegive chasebench visewhite cakewhite cellbee orchidevery inchhead voicebirch beer
...View all with 9 letters...
Words (333)
helicopterscreechingwheelchairchandelieranestheticchimpanzeewinchestermouthpiecetelepathicdecipheredaestheticsarchimedesincoherentschweitzerenrichmentempatheticmechanizedtechnetiumcephalexintelephonicmechanisedachievableexothermicchemisettemetternichcharioteernecrophilechanceriesclomiphenetheoreticsdehiscencerechristenhatcheriescheliceraebeseeching
...View all with 10 letters...
Phrases (39)
by the piecehome officerive gauchechigoe fleawhite sauceheroic poemsteve reichheroic taleside chapellitchi tree
...View all with 10 letters...
Words (439)
inheritanceachievementmerchandisetheoreticaltherapeuticpsychedelicanaesthetichyperactivediscothequepitchblendeinterchangeclotheslinearchdioceseimpeachmentneckerchiefkitchenettechippendalepsychedeliachanticleeroverachievebewitchmentendothermiclectureshipincoherenceschlesingerchickenfeedhermeneuticthickheadedtelegraphicterpsichoreimpeachablewindcheaterunaestheticperchlorideeuphemistic
...View all with 11 letters...
Phrases (84)
fire watcherfemale childsecond reichchemin de ferchinese wallchief josephion exchangefixed chargetrench knifecheshire cat
...View all with 11 letters...
Words (489)
architecturehandkerchiefcheerleadingmichelangelolichtensteincharacterizeauthenticatespeechwriterincoherentlycinemathequespeechmakingencephalitishomesicknessmerchandiseranaestheticsdisenchantedphylogeneticapothecariesreschedulinghermeticallytheoreticianstereophonicchesterfieldoverachieverrhinocerosesoverreachinggemeinschaftneurasthenicaestheticismhyperkineticencephalitichomeothermicsceneshifterreceivershipchastisement
...View all with 12 letters...
Phrases (149)
space vehiclehead coveringchinese aniseathletic gameathletic typekitchen rangechinese deitykitchen stoveweaver's hitchcrepe de chine
...View all with 12 letters...
Words (428)
theoreticallycomprehensioncomprehensivecharacterizedauthenticatedphotoelectricpetrochemicalcounterweightaestheticallyunderachieverhydroelectrichousecleaningliechtensteinunimpeachablecharacterisedhypercalcemiathoracentesishyperglycemictetrachlorideacetylcholineterpsichoreanhermeneuticalbacteriophagehypervelocitychameleonlikeaffenpinschermorphogeneticparentheticalacetaminophenaeromechanicscrotchetinesshematopoieticpsychogeneticthymectomizescomprehending
...View all with 13 letters...
Phrases (195)
delphic oraclearcheozoic eonczech republicephedra sinicafriar preacherget the picturemachine gunnervictor herbertchicken littlechicken manure
...View all with 13 letters...
Words (419)
apprenticeshipcomprehensiblecholinesteraseindecipherablechemosynthesismetempsychosistelepathicallyunderachievingirreproachableworcestershiredisenchantmentextravehicularchickenhearteddisenfranchisemechanicalnesselectrochemistdisinheritancetelephonicallychemosyntheticservomechanismcoquettishnessundecipherableempatheticallycomprehendiblecyproheptadinerhinencephalonmethodicalnessoceanographiesphotoreceptivecomprehensiblycomprehensionscounterweightschemoreceptionhyperkeratotichemerocallises
...View all with 14 letters...
Phrases (238)
paleolithic agebreathing placenoachian delugebreathing spacesilver chloridecastle in the airto a higher placewhite blood cellischemic strokekitchen cabinet
...View all with 14 letters...
Words (309)
cinematographerdisenfranchisedinterchangeableelectrophoresisparentheticallycounterweightedgloucestershiretherapeuticallyenfranchisementstereochemistrymischievousnesscatheterizationincomprehensioneuphemisticallyuncomprehendingatherosclerosiscomprehensivelyincomprehensiveelectrochemicalchurrigueresquekinestheticallycholecalciferolphosphocreatineacetophenetidinatheroscleroticechinodermatousthyroidectomiesnonachievementscountercheckingpsychedelicallymischaracterizechildlessnesseschildlikenessescyproheptadinesanticholesterol
...View all with 15 letters...
Phrases (318)
bitter chocolatehigh renaissancesir john herschelacheta domesticaathletic contestpsychotic beliefchemical balancechemical defensechocolate eclairmerce cunningham
...View all with 15 letters...
Words (142)
incomprehensiblehemorrhoidectomyincomprehensiblychemotherapeuticphylogeneticallyelectrochemistryoverenthusiasticunderachievementmiscomprehensionradiochemistriesspectroheliogramuncomprehensiblethermometricallymicrogametophyteantitechnologiesnoncomprehensivehypersusceptiblehyperviscositiescounterweightingroentgenographicpostencephalitichypophysectomiesthyroidectomizedarchconservativefeatherstitchinghypophysectomisearchiepiscopateshypophysectomizerechoreographingstereophonicallycyclohexylamineszannichelliaceaehippocastanaceaeoxyphencycliminemachineabilities
...View all with 16 letters...
Phrases (292)
hypodermic needlemanihot esculentachelonian reptilesonic depth finderwilliam wycherleynathaniel currierpuerto rico trenchtelephone circuitmetric weight unitrendering machine
...View all with 16 letters...
Words (86)
chemiluminescencecomprehensivenesspsychotherapeuticelectromechanicalhyperreactivitiesmiscomprehensionsthermoluminescentphysiotherapeuticcercidiphyllaceaespectroheliogramsunexchangeabilityspectroheliographthermoperiodicityleukoencephalitisspectrohelioscopedisfranchisementscrashworthinesseschlortetracyclinehypophysectomizesarchconservativeshypophysectomisedmorphogeneticallyhypophysectomizedencephalomyelitisstereochemistriesmachine-accessiblemachine-controlledimmunochemistriesnucleophilicitiestrichloroethylenepharisaicalnessespharmacotherapiesechocardiographernephelometricallyelectrochemically
...View all with 17 letters...
Phrases (353)
jacqueline cochrancompetence hearinggenus globicephalacivil rights leaderclomiphene citrateczech monetary unithandicapped personhypoglycemic agentjacques tatischefferithacus rubecola
...View all with 17 letters...
Words (55)
spectrophotometricdisenfranchisementinterchangeabilitythermoluminescencespectroheliographsspectroheliographythermoplasticitiesspectrohelioscopesnoncomprehensivelypsychotherapeuticsarchaeoastronomiescreditworthinessesrechromatographiescomprehensiblenessstereophotographicaustralopithecinestrichlormethiazidehypercholesteremiaechocardiographersphenomenologicallyechocardiographiesplasmodiophoraceaecharacteristicnesschemotherapeuticalelectrochemistriesdehydrochlorinasesdehydrochlorinateddehydrochlorinatesmechanochemistriestrichloroethylenesnoninterchangeableaerothermodynamicselectromyographiescherbourg-octevilleanticholinesterase
...View all with 18 letters...
Phrases (320)
lachrymal secretionedgar rice burroughsgeorge michael cohanclass schizomycetesread-only memory chipfamily trichechidaecerebral hemispheregenus chamaecytisuslouis-hector berliozfamily loranthaceae
...View all with 18 letters...
Words (42)
thermoluminescencesdisenfranchisementsthermoperiodicitieshypersusceptibilityspectrophotometriesparathyroidectomiesparthenogeneticallyencephalomeningitiscomprehensibilitiescomprehensivenessesresorcinolphthaleincytopathogenicitiesphenomenalisticallyphenylthiocarbamideelectrocardiographsneuropharmacologieselectromechanicallymeningoencephaliticmeningoencephalitiselectrophoreticallyelectrophotographicelectrophysiologieselectrophysiologistreticuloendothelialelectroretinographselectroretinographyincomprehensibilityencephalomyelitidesanticholinesterasesphotoreconnaissancehydroxytetracyclinepseudosophisticatedhydrometeorologicaldiethylcarbamazinesinterchangeableness
...View all with 19 letters...
Phrases (293)
rejoicing over the lawgiles lytton stracheycaesalpinia echinatateacher's certificatepounds per square inchstephen michael reichteaching certificatemechanical advantagestephen vincent benetirish gaelic language
...View all with 19 letters...
Words (34)
hypercholesterolemiaoverenthusiasticallyparadichlorobenzenesspectroheliographiesspectrophotometricalparathyroidectomizedhyperadrenocorticismcomprehensiblenessesphenylthiocarbamidesinterchangeabilitiesacetylcholinesterasepseudohermaphroditicelectrooculographieselectrophotographieselectrophysiologicalelectrophysiologistsanthropocentricitieselectroretinographicincomprehensiblenessmicroelectrophoresesmicroelectrophoresismicroelectrophoreticroentgenographicallyencephalomyocarditischemotherapeuticallypseudocholinesterasephotoreconnaissanceshypercholesterolemichypercoagulabilitiesnephroangiosclerosishyperconsciousnessesheterobasidiomycetesirreproachablenesseselectrocardiographicPhrases (256)
archeological remainsblack-capped chickadeegilbert charles stuartyellow-shafted flickerwyethia amplexicaulisfamily phytolaccaceaefamily trachipteridaestephen collins fosterbalance sheet analysisfamily dermochelyidae
...View all with 20 letters...
Words (16)
hypersusceptibilitiesimmunocytochemistriesimmunoelectrophoresesimmunoelectrophoreticinterchangeablenesseselectrocardiographiesacetylcholinesterasesmeningoencephalitideselectromyographicallyimmunoelectrophoresiselectroretinographiesincomprehensibilitiespseudocholinesterasesarenaria-melanocephalahypercholesterolemiaspsychotherapeuticallyPhrases (231)
acrocentric chromosomecercopithecus aethiopshelianthemum scopariumanthriscus cereifoliumhelichrysum bracteatumtelephone conversationarchitectural ornamentketorolac tromethaminepharmaceutical chemistbyzantine architecture
...View all with 21 letters...
Words (8)
spectrophotometricallyimmunohistochemistriesintercomprehensibilityelectrophysiologicallyincomprehensiblenessesencephalomyocarditisesmicrospectrophotometermicrospectrophotometryPhrases (216)
gilbert keith chestertongregorian calendar monthhaliaeetus leucorhyphustrazodone hydrochloridebarbara wertheim tuchmanleishmaniasis americanateacher-student relationcapital of liechtensteinbattle of the bismarck seapartnership certificate
...View all with 22 letters...
Words (4)
electroencephalographicdichlorodifluoromethanemicrospectrophotometersmicrospectrophotometricPhrases (120)
parenthetical expressiontransient ischemic attackchlorpheniramine maleatearchibald percival wavellmeperidine hydrochlorideelectromechanical devicepharmacological medicinearistolochia serpentariacapital of the netherlandscapital of the philippines
...View all with 23 letters...
Words (7)
electrocardiographicallyintercomprehensibilitieselectroencephalographiesmicroelectrophoreticallydichlorodifluoromethanesmicrospectrophotometriesschizosaccharomycetaceaePhrases (118)
argyroxiphium sandwicenseprivately held corporationtrip the light fantastic toeprimary sex characteristicbrassica oleracea acephalacapital of northern irelanddmitri ivanovich mendeleevarthur meier schlesinger jr.richard buckminster fullerfluoxetine hydrocholoride
...View all with 24 letters...
Words (1)
immunoelectrophoreticallyPhrases (98)
battle of the chemin-des-dameschemical weapons conventioncruel and unusual punishmentdistinguished service medalfriedrich wilhelm nietzschetherapeutic rehabilitationboris leonidovich pasternakmodest petrovich mussorgskyrudolf christian karl dieselpropoxyphene hydrochloride
...View all with 25 letters...
Phrases (74)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanfrances eliza hodgson burnettx-linked dominant inheritancebacon-lettuce-tomato sandwichright atrioventricular valvecorrectional rehabilitationhunting and gathering societywar of the austrian successionanton grigorevich rubinstein
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (47)
nikita sergeyevich khrushchevholy roman emperor frederick iialeksandr sergeyevich pushkinelectromechanical transducerdirector-stockholder relationfreedom from search and seizurejerusalem artichoke sunfloweradrenocorticotrophic hormonecryptobranchus alleganiensistaras grigoryevich shevchenko
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (57)
aleksandr feodorovich kerenskyephippiorhynchus senegalensistriphosphopyridine nucleotideoxytetracycline hydrochloridemarcus junius brutus the youngercommission on the status of womendemocratic republic of the congofeodor mikhailovich dostoevskifeodor mikhailovich dostoevskydepartment of homeland security
...View all with 28 letters...
Phrases (37)
aleksandr nikolayevich scriabinchemical decomposition reactionfriedrich wilhelm august froebeldisorganized type schizophreniacapital of the dominican republicsouth-central dravidian languagecapital of the russian federationsao thome e principe monetary unithydrangea macrophylla hortensisconstitution of the united states
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (26)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library sciencejacques anatole francois thibaultethylenediaminetetraacetic acidrepublic of bosnia and herzegovinaaugust friedrich leopold weismannwaterhouse-friderichsen syndromeplasma thromboplastin antecedent
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (25)
united states public health servicebureau of intelligence and researchsecond epistle to the thessalonianssir john frederick william herschelfrances elizabeth caroline willardchickasaw national recreation areaposterior vein of the left ventricleanicius manlius severinus boethiusislamic jihad movement in palestineoscar fingal o'flahertie wills wilde
...View all with 31 letters...
Phrases (13)
nikolai andreyevich rimski-korsakovafrican american vernacular englishhierarchical classification systemsergei aleksandrovich koussevitzkystraight-line method of depreciationnikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylatetheory of electrolytic dissociationedmond louis antoine huot de goncourt
...View all with 32 letters...
Phrases (19)
characteristic root of a square matrixbreach of trust with fraudulent intentbureau of alcohol tobacco and firearmselizabeth cleghorn stevenson gaskellmusculus sphincter ductus choledochisir winston leonard spenser churchillright to speedy and public trial by jurykonstantin sergeyevich stanislavskydisease of the neuromuscular junctionmercury-in-glass clinical thermometer
...View all with 33 letters...
Phrases (14)
jacques francois fromental elie halevychronic obstructive pulmonary diseasefederal islamic republic of the comorosinterstitial cell-stimulating hormonemusculus sphincter ductus pancreaticifriedrich august kekule von stradonitzdryopithecus rudapithecus hungaricusmassachusetts institute of technologyfederal home loan mortgage corporationdepartment of health and human services
...View all with 34 letters...
Phrases (11)
national technical information servicejohann christoph friedrich von schillercommunications security establishmentcomte donatien alphonse francois de sadeimmaculate conception of the virgin marychristopher william bradshaw isherwoodfederal democratic republic of ethiopiatransurethral resection of the prostatesubacute sclerosing leukoencephalitisselective-serotonin reuptake inhibitor
...View all with 35 letters...
Phrases (10)
angiotensin-converting enzyme inhibitorchurch of jesus christ of latter-day saintsfreedom from cruel and unusual punishmenttripleurospermum oreades tchihatchewiialbert francis charles augustus emmanuelsecretary of health education and welfarealbrecht eusebius wenzel von wallensteinsocialist people's libyan arab jamahiriyabaron karl maria friedrich ernst von weberdeclining balance method of depreciationPhrases (6)
national oceanic and atmospheric administrationcooper union for the advancement of science and artfifth amendment to the united states constitutionfirst amendment to the united states constitutionarmenian secret army for the liberation of armeniainternational society for krishna consciousnessPhrases (6)
nineteenth amendment to the united states constitutionfourteenth amendment to the united states constitutionfood and agriculture organization of the united nationseighteenth amendment to the united states constitutionunited nations international children's emergency fundunited society of believers in christ's second appearing
