Words Containing: E,I,C
(In Any Order)
There are 40,329 words,
18,671 phrases and
0 abbr's with
E,I,C in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
cazique | 7 | 27 | nounn | |||||
noun • black-and-red or black-and-yellow orioles of the American tropics | ||||||||
cyclize | 7 | 23 | verbv | |||||
verb • To undergo, or cause to undergo, a reaction resulting in the formation of an aromatic or ring structure. | ||||||||
enzymic | 7 | 23 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
zecchin | 7 | 23 | nounn | |||||
Valid word for Scrabble US
| ||||||||
zincked | 7 | 23 | ||||||
Valid word for Scrabble US
| ||||||||
quicker | 7 | 22 | adverb, adjectiveadv, adj | |||||
adverb • more quickly | ||||||||
quickie | 7 | 22 | nounn | |||||
noun • hurried repair | ||||||||
quicken | 7 | 22 | verbv | |||||
verb • move faster • make keen or more acute • give life or energy to • show signs of life • give new life or energy to | ||||||||
pickaxe | 7 | 22 | verb, nounv, n | |||||
noun • a heavy iron tool with a wooden handle and a curved head that is pointed on both ends | ||||||||
hexylic | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
iceWords (616)
policeofficechoicedecidenoticepickedprinceclientticketcreditadvicedirectmexicocirclecinemadevicemickeywickednicelycitiesactivecopiescookiecruiseincomepencilvenicerecipefiercegracieexoticfiancecassieheroicinsect
...View all with 6 letters...
Phrases (18)
cup tiecow piecage inice capclue inice teain casedry icede sicail duce
...View all with 6 letters...
Words (1705)
specialpicturedecidedofficeramericamichaelcertainservicemachinechickencharliekitchenchinesesuicidesocietymedicalnoticedscienceexcitedjusticesilenceancientdivorcemiraclelicensereceivesectionvehiclecarriedspeciesarticleachievecitizencookiesmexican
...View all with 7 letters...
Phrases (53)
air cellrib cageski racecake mixthe citydice boxdice cuparc sineice overice pick
...View all with 7 letters...
Words (3301)
childrenamericanaccidentsecuritycontinueevidencedirectordecisionprincesspracticeinnocentconsidermedicinereceiveddistanceaudiencecheeringexcitingviolencebecomingpatheticcleaningpreciousdirectlyteachingincidentcheatingconvinceservicesdivorcedexercisedescribereactionterrificpatience
...View all with 8 letters...
Phrases (129)
w. c. fieldsair coverhead licepipe rackpecan pieclosed injail cellwar crimewind conebrick red
...View all with 8 letters...
Words (5038)
certainlyscreamingdetectiveintroducerecognizeinsurancedeliciouscigaretteexpectinginspectorcommitteddirectioneducationsacrificesearchingconvincedcommitteepolicemanexistenceconfirmedinfluencerecordingcatherinescientistpreciselyconfidentexecutivereceptionaffectiontechniqueeffectivecontinuedobjectiondiscoverytechnical
...View all with 9 letters...
Phrases (327)
felis oncaby machinedirect dye.45-caliberfish slicehip pocketgill cleftmetric tonitchy feetair jacket
...View all with 9 letters...
Words (5976)
especiallydifferenceexperienceappreciateincrediblediscoveredconnectionprotectionconsideredconfidencechatteringattractivecollectionconsciencecommercialprotectingincrediblyhelicopterscientificmedicationconfessionintroducedresistancerecognizedcommitmentdisciplineassistancedirectionsimportanceexcitementelectricalconvenientconventionscreechingcompliment
...View all with 10 letters...
Phrases (571)
disk accesscoffee ringdirect costair cleanerline backercubage unittv audiencesilver cordair currentspecial act
...View all with 10 letters...
Words (6137)
complicatedcompetitioncoincidenceelectricitydestructionconsideringexperiencednecessarilytechnicallycelebratingmagnificentcertificatecelebrationcommunicatedescriptionperspectivechristopherparticipatemaintenancecooperationcountrysidecoordinateschallengingmasterpieceappreciatedprosecutioncomplimentsrecognitioninheritanceconvenienceexceptionalachievementmathematicscompetitivecompromised
...View all with 11 letters...
Phrases (957)
isaac singercatha edulisleave officetribal chiefflower chainflower childslide actionbitter cressclass periodgreat schism
...View all with 11 letters...
Words (5491)
conversationintelligencesurveillancecommissionerspecificallyindependenceaccomplishedaccidentallyintellectualprescriptionconfidentialarchitecturecompensationdifficultiesresurrectionacquaintanceconservativeexperiencinghandkerchiefinterferenceincreasinglyappreciationsignificanceconventionaldisconnectedcontaminatedconsiderablecongregationenthusiasticcheerleadingcircumstanceintersectionincidentallymichelangeloparticipated
...View all with 12 letters...
Phrases (1200)
alec guinnessfilm directorgrain cleanerserious musicknuckle jointlake michigancarniolan beecover versionczech capitalmolly pitcher
...View all with 12 letters...
Words (4347)
circumstancesconsciousnessconcentrationsophisticatedgrandchildrenconsiderationdisappearanceunpredictableinconveniencecontroversialreincarnationdisrespectfulunnecessarilyconcentratingtheoreticallycompassionateschizophreniaschizophrenicconstellationtechnologicalinexperiencedarchaeologistdocumentationexceptionallyconscientiouscongressionalmathematicianarchitecturalinstinctivelycomprehensioncontemplatinginconsideratecomprehensiveirreplaceablecondescending
...View all with 13 letters...
Phrases (1496)
bakke decisionpartial breachfelis concolorharvey cushingaleatory musicoutside clinchcartridge clipchannel islanddelphic oracledirect antonym
...View all with 13 letters...
Words (3232)
identificationrecommendationpharmaceuticalreconstructionscientificallyreconciliationinfrastructurecharacteristicreconnaissanceczechoslovakiahypotheticallyaccomplishmentcinematographyarchaeologicalsystematicallyindestructibleconstantinopleunconventionalintellectuallycoincidentallymetaphoricallyaffectionatelyelectronicallyinconveniencedapprenticeshipinterconnectedoverprotectivedemocraticallyexcommunicatedunrecognizablecontemporariesmathematicallyindiscriminaterespectabilitymeteorological
...View all with 14 letters...
Phrases (1820)
family apiaceaealpine clubmossconiferous treedirect contrastmarc blitzsteinmuscular tissuecircuit breakerprivate citizenjacques cartierclementine tree
...View all with 14 letters...
Words (2215)
electromagneticconfidentialitycinematographerextracurricularpsychotherapistunconsciousnesstechnologicallypithecanthropusdecontaminationpersonificationintussusceptionunsophisticateddisenfranchisedinconsequentialdisrespectfullyinterchangeableintercollegiateexcommunicationczechoslovakianconscientiouslydemocratizationsympathomimeticdolichocephalicindemnificationelectrophoresissynergisticallyinaccessibilitycontraindicatedbioluminescencecompetitivenessdiscombobulateddestructivenessuncommunicativeinconveniencinguncontroversial
...View all with 15 letters...
Phrases (1852)
measuring deviceauditory ossiclepanel discussionfelis domesticusstay of executioniridaceous plantcapital of francefalco peregrinusjunction barrierbenefit of clergy
...View all with 15 letters...
Words (870)
incomprehensibleenthusiasticallyintercontinentalindiscriminatelyelectromagnetismcounterterroristundersecretariestranscontinentalincontrovertiblecounterclockwisehemorrhoidectomycharacterizationincomprehensiblyaustralopithecuscounteroffensivecounterterrorismpseudoscientificcountersignatureunpredictabilitycounterespionagecounterintuitivechemotherapeuticphylogeneticallyuncharacteristicmicroelectronicsimperceptibilityelectromagneticsstereomicroscopemultidirectionalintellectualizedpharmaceuticallyintraventricularovercompensationovercomplicatingunapologetically
...View all with 16 letters...
Phrases (1698)
hypodermic needletympanic membranecommedia dell'arteczar alexander iiigenus utriculariamanihot esculentaatopic dermatitiscartridge ejectorstrictly speakingcapital of georgia
...View all with 16 letters...
Words (544)
counterproductivetelecommunicationconversationalistcommercializationcounterinsurgencymisidentificationunconventionalitybacteriologicallytranscendentalismcounterrevolutionconscientiousnesssuperconductivityelectrocardiogramdeconstructionistelectroconvulsivecompartmentalizedparathyroidectomyreconstructionismmaterialisticallyreconstructionistchemiluminescenceintellectualizingcardiorespiratoryelectrostaticallycomprehensivenessthermodynamicallyinconsequentiallytranscendentalistsocioeconomicallycompartmentalisedpsychotherapeuticelectromechanicalinterdisciplinarycounterscientifichyperreactivities
...View all with 17 letters...
Phrases (1671)
horizontal sectioncapital of ethiopiacastilian languageobject recognitionjacqueline cochranlarix occidentalismary leontyne pricecompetence hearingdirect correlationpontederia cordata
...View all with 17 letters...
Words (302)
telecommunicationscharacteristicallycompartmentalizinginconsequentialityhypercoagulabilityinterconnectednessoversimplificationspectrophotometricantivivisectionistdisenfranchisementinterchangeabilityneuropsychologicalpaleoclimatologistthermoluminescencepolyesterificationcommensurabilitiesmisidentificationsspectroheliographscommercializationscounterstrategistsspectroheliographythermoplasticitiescountersuggestionspolyribonucleotidespectrohelioscopesnoncomprehensivelyunpredictabilitiesunprinciplednessescommunicablenessesrambunctiousnessesarteriolosclerosisappreciativenessesmonochromaticitiespsychotherapeuticscompanionabilities
...View all with 18 letters...
Phrases (1475)
hindu calendar monthbombycilla cedrorunoceanites oceanicusdouble-deck carriageerinaceus europaeusamerican revolutiontuamotu archipelagoisabella i of castileanamnestic reactionprivate corporation
...View all with 18 letters...
Words (209)
counterintelligencehydrochlorothiazidesternocleidomastoidelectroluminescenceintellectualizationcinematographicallyspectrofluorometricthermoluminescencespolyesterificationsdisenfranchisementsthermoperiodicitiesextralinguisticallycountersurveillancepolyribonucleotideshypersusceptibilityantivivisectionistsspectrophotometriesparathyroidectomiesultracentrifugationnonproductivenessessurface-assimilativecommunicativenessesparthenogeneticallycompanionablenessesunconscientiousnessnonrelativisticallycompassionatenessesencephalomeningitismucopolysaccharidescomplementarinesseslipopolysaccharidesreconceptualizationcomprehensibilitiesdisrespectabilitiescomprehensivenesses
...View all with 19 letters...
Phrases (1219)
acetylsalicylic acidrecursive definitionfavourable receptionerinaceus europeaeusallium cepa viviparumaquilegia canadensisfamily cyclopteridaefamily cynoglossidaerejoicing over the lawsuperior conjunction
...View all with 19 letters...
Words (113)
counterrevolutionaryuncharacteristicallycompartmentalizationhypercholesterolemiaoverenthusiasticallytetrahydrocannabinolparadichlorobenzenesspectrofluorometriessemiautobiographicalspectroheliographieskeratoconjunctivitesradiopharmaceuticalscountersurveillancesspectrophotometricalparathyroidectomizedcounter-revolutionistunsatisfactorinessesreconceptualizationshyperadrenocorticismcomprehensiblenessescounterdemonstrationcytodifferentiationsimmunocytochemicallyintellectualizationsmagnetofluiddynamicsbacteriochlorophyllsphenylthiocarbamidesinterchangeabilitiesimmunoprecipitationsacetylcholinesterasepseudohermaphroditicoophorosalpingectomyneuroendocrinologiescounterrevolutionistneuroendocrinologist
...View all with 20 letters...
Phrases (940)
sweet-scented geraniumarcheological remainsallium cepa aggregatumblack-capped chickadeecalendula officinalisgilbert charles stuartyellow-shafted flickerscandinavian languageappendicular skeletonwyethia amplexicaulis
...View all with 20 letters...
Words (35)
hypersusceptibilitiescompartmentalizationsstereomicroscopicallyimmunocytochemistriesconstructive-metabolicimmunoelectrophoresesimmunoelectrophoreticinterchangeablenesseselectrocardiographiesacetylcholinesterasesneuroendocrinologicalneuroendocrinologistsinterconvertibilitiesadrenocorticosteroidsadrenocorticotrophinsmeningoencephalitideselectromyographicallybuckminsterfullerenesdendrochronologicallyovercommercializationimmunoelectrophoresiselectroretinographiesincomprehensibilitiespseudocholinesterasesarenaria-melanocephalapseudosophisticationscounterdemonstrationsoverintellectualizingunconstitutionalitiesantiferromagneticallyhypercholesterolemiaspsychotherapeuticallycounterinterpretationunexceptionablenessestetrahydrocannabinolsPhrases (730)
use of goods and servicesacrocentric chromosomesierra madre occidentaldirect electric currentexperimental conditioncercopithecus aethiopshelianthemum scopariumicelandic monetary unitanaphalis margaritaceadiametrical opposition
...View all with 21 letters...
Words (13)
counterrevolutionarieskeratoconjunctivitideskeratoconjunctivitisesspectrophotometricallyimmunohistochemistriesintercomprehensibilityovercommercializationselectrophysiologicallyincomprehensiblenessesencephalomyocarditisesmicrospectrophotometercounterinterpretationsmicrospectrophotometryPhrases (606)
disjunctive conjunctionlycopersicon esculentumadministrative districtgilbert keith chestertongregorian calendar monthprunus persica nectarinahaliaeetus leucorhyphusadministrative officialcoronavirus disease 2019trazodone hydrochloride
...View all with 22 letters...
Words (5)
electroencephalographicoverintellectualizationdichlorodifluoromethanemicrospectrophotometersmicrospectrophotometricPhrases (405)
gilbert and ellice islandsparenthetical expressiontransient ischemic attacktribasic sodium phosphatesecond battle of el alameinchlorpheniramine maleatearchibald percival wavellmeperidine hydrochloridenikolai vasilievich gogolsubpoena ad testificandum
...View all with 23 letters...
Words (10)
microgramma-piloselloideslaryngotracheobronchitiselectrocardiographicallyintercomprehensibilitieselectroencephalographiesmicroelectrophoreticallyoverintellectualizationsdichlorodifluoromethanesmicrospectrophotometriesschizosaccharomycetaceaePhrases (332)
carnegie mellon universityargyroxiphium sandwicensesubdivision deuteromycotamary wollstonecraft godwinunidentified flying objectprivately held corporationtrip the light fantastic toecapture of fort ticonderogaprimary sex characteristicsir terence mervyn rattigan
...View all with 24 letters...
Words (1)
immunoelectrophoreticallyPhrases (258)
count ferdinand von zeppelinunited states secret servicecluster of differentiation 4cosmic microwave backgroundbureau of justice assistancebureau of justice statisticsmiguel de cervantes saavedramusculus quadriceps femorisfrancis scott key fitzgeraldbattle of the chemin-des-dames
...View all with 25 letters...
Phrases (170)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanchannel islands national parkfrances eliza hodgson burnettshort-spurred fragrant orchidx-linked dominant inheritanceconfederate states of americabacon-lettuce-tomato sandwichright atrioventricular valvebrassica oleracea gongylodes
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (126)
american revolutionary leadernikita sergeyevich khrushchevholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinelectromechanical transduceroffice of management and budgetsolenostemon scutellarioidesdirector-stockholder relationfreedom from search and seizure
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (122)
interstate commerce commissionaleksandr feodorovich kerenskybusiness process reengineeringephippiorhynchus senegalensistriphosphopyridine nucleotideoxytetracycline hydrochloridemarcus junius brutus the youngerstrategic arms limitation talksfyodor mikhailovich dostoevskifyodor mikhailovich dostoevsky
...View all with 28 letters...
Phrases (95)
business interruption insurancesecond council of constantinoplealeksandr nikolayevich scriabinchemical decomposition reactionacrylonitrile-butadiene-styreneantisocial personality disordermale internal reproductive organfriedrich wilhelm august froebelnational volunteers associationdisorganized type schizophrenia
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (65)
battle of spotsylvania court housebattle of spotsylvania courthousemusculus sternocleidomastoideusreduced instruction set computingalexander isayevich solzhenitsynglutamic oxalacetic transaminaseobsessive-compulsive personalitybachelor of arts in library sciencedepartment of energy intelligencecoluber constrictor flaviventris
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (63)
united states public health servicebureau of intelligence and researchsecond epistle to the thessaloniansdigital communications technology2019-ncov acute respiratory diseasepetroselinum crispum neapolitanumguiseppe fortunino francesco verditupac amaru revolutionary movementsidonie-gabrielle claudine colettesir john frederick william herschel
...View all with 31 letters...
Phrases (41)
nikolai andreyevich rimski-korsakovafrican american vernacular englishpatent and trademark office databasehierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyintercontinental ballistic missilestraight-line method of depreciationrevolutionary justice organizationobject-oriented programing language
...View all with 32 letters...
Phrases (37)
characteristic root of a square matrixlinear-quadratic-gaussian controllermusical instrument digital interfacebreach of trust with fraudulent intentcongress of industrial organizationslycopersicon esculentum cerasiformeobject-oriented programming languagemusculus abductor digiti minimi pedisbureau of alcohol tobacco and firearmsmusculus obliquus externus abdominis
...View all with 33 letters...
Phrases (33)
jacques francois fromental elie halevyconfidential adviser-advisee relationchronic obstructive pulmonary diseasefederal islamic republic of the comorosfederal national mortgage associationacademy of television arts and sciencesnero claudius caesar drusus germanicuscosmic microwave background radiationinterstitial cell-stimulating hormonemusculus sphincter ductus pancreatici
...View all with 34 letters...
Phrases (23)
national technical information servicejohann christoph friedrich von schillercommunications security establishmentinternational development associationunited states postal inspection servicetadeusz andrzej bonawentura kosciuszkocomte donatien alphonse francois de sadecanadian security intelligence serviceimmaculate conception of the virgin marycockcroft and walton voltage multiplier
...View all with 35 letters...
Phrases (25)
center for disease control and preventionrank-difference correlation coefficientangiotensin-converting enzyme inhibitorforeign intelligence surveillance courtchurch of jesus christ of latter-day saintsnational geospatial-intelligence agencyjuan carlos victor maria de borbon y borbonfield-sequential color television systemfreedom from cruel and unusual punishmenttripleurospermum oreades tchihatchewii
...View all with 36 letters...
Phrases (19)
severe combined immunodeficiency diseaseunited states declaration of independenceketoacidosis-resistant diabetes mellitusuniversity of north carolina at chapel hillattention deficit hyperactivity disordercentre for international crime preventiondemocratic and popular republic of algeriagenerally accepted accounting principlesdemocratic socialist republic of sri lankatrivalent live oral poliomyelitis vaccine
...View all with 37 letters...
Phrases (12)
general certificate of secondary educationunited states government accounting officeobject-oriented database management systemsecond epistle of paul the apostle to timothyalexis charles henri maurice de tocquevilledemocratic republic of sao tome and principeinternational civil aviation organizationeconomic commission for asia and the far eastmarie joseph paul yves roch gilbert du motieradvanced research and development activity
...View all with 38 letters...
Phrases (10)
million floating point operations per secondbillion floating point operations per secondrussian soviet federated socialist republicdefense reutilization and marketing serviceislamic jihad for the liberation of palestinedirectorate for inter-services intelligencegates of the arctic national park and preservenucleoside reverse transcriptase inhibitorfuerzas armadas revolucionarios de colombiaenzyme-linked-immunosorbent serologic assayPhrases (12)
nicotinamide adenine dinucleotide phosphateassociation of islamic groups and communitiesminnesota multiphasic personality inventoryrevolutionary proletarian initiative nucleinational archives and records administrationprayer of azariah and song of the three childrenregents of the university of california v. bakkerussian soviet federative socialist republicinternational relations and security networkursulines of mary immaculate virgin of gandino
...View all with 40 letters...
Phrases (9)
revolutionary organization of socialist muslimsnational oceanic and atmospheric administrationtransmission control protocol/internet protocolcooper union for the advancement of science and artfifth amendment to the united states constitutionfirst amendment to the united states constitutionarmenian secret army for the liberation of armeniamedical literature analysis and retrieval systeminternational society for krishna consciousnessPhrases (6)
association for the advancement of retired personsprayer of azariah and song of the three holy childrengeorges leopold chretien frederic dagobert cuvierconte alessandro giuseppe antonio anastasio voltafirst epistle of paul the apostle to the corinthiansunited states army criminal investigation commandPhrases (8)
international bank for reconstruction and developmentnineteenth amendment to the united states constitutionfourteenth amendment to the united states constitutionfood and agriculture organization of the united nationseighteenth amendment to the united states constitutionunited nations international children's emergency fundroyal society of london for improving natural knowledgeunited society of believers in christ's second appearing