Words Containing: E,G,E,I
(In Any Order)
There are 9,248 words,
6,464 phrases and
0 abbr's with
E,G,E,I in.
Best Scoring Words With: E,G,E,I
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
feezing | 7 | 20 | ||||||
Valid word for Scrabble US
| ||||||||
heezing | 7 | 20 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
grecize | 7 | 19 | verbv | |||||
verb • To render Grecian, or cause (a word or phrase in another language) to take a Greek form. • To translate into Greek. • To conform to the Greek custom, especially in speech. | ||||||||
elegize | 7 | 17 | verbv | |||||
verb • compose an elegy | ||||||||
jeeping | 7 | 17 | verbv | |||||
Valid word for Scrabble US
| ||||||||
agenize | 7 | 17 | verbv | |||||
verb • age or bleach flour with Agene (nitrogen trichloride) | ||||||||
keeking | 7 | 16 | ||||||
verb • To peek; peep. | ||||||||
jeering | 7 | 15 | verb, adjectivev, adj | |||||
noun • showing your contempt by derision adjective satellite • abusing vocally; expressing contempt or ridicule | ||||||||
exigent | 7 | 15 | adjectiveadj | |||||
adjective satellite • demanding attention • requiring precise accuracy | ||||||||
weighed | 7 | 15 | verbv | |||||
verb • have a certain weight • show consideration for; take into account • determine the weight of • have weight; have import, carry weight • to be oppressive or burdensome | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (226)
feelingeveningmeetingkeepingfeedingseekinggenuinegeneticweepingfleeinghygienegenesisiceberglineagegalileemileagepeelingfreeinggentilegenericseemingteemingjeeringeugeniaregimenseepingreekingbesiegespiegelgeordiefeignedlegiblebeguileingenueperigee
...View all with 7 letters...
Phrases (9)
get wisee regionbe givengeorge ifig treebig treehedge inwig treegive earWords (562)
sleepingfeelingscheeringbleedingnegativedesignedfreezingregisterengineerenteringdesignereighteendisagreebreedingspeedingregimentsteeringgreetingresignedsweepingheritageeveningslingerieprestigeeyesightgenocidecreepingeligiblebeginneremerginggeniusesagreeinggeneticsfleetingwheezing
...View all with 8 letters...
Phrases (26)
george ivegg whiteegg yieldmine cagegeorge iimagic eyebee stinggeorge vifried eggwage hike
...View all with 8 letters...
Words (1056)
recognizecigaretteexpectingbelievingdelightedrecognisenegotiatedefendingreceivingprivilegeforeignerrepeatingreferringgroceriesreleasingrevealingscreeningsovereigndeceivingsqueezinggenuinelyseeminglyenergeticenlightensiegfriedpesteringconciergeguinevereespionagespielbergdigestivesteinbergdetectingexecutingrefueling
...View all with 9 letters...
Phrases (73)
line judgeliege lordde rigueurseeing redivy leagueguide ropeview anglebig leagueguinea henside judge
...View all with 9 letters...
Words (1300)
everythinggenerationfrightenedpretendingrecognizedaggressiveregisteredscreechingvegetariandevelopingdepressinglegitimaterehearsingrefreshingprivilegedrecoveringrecognisedgenerosityallegianceingredientdesignateddelegationoverweightexercisingrespectingproceedingvegetationnegotiabledescendingmargueriteintegratedgeneratingreflectingnegligencesentencing
...View all with 10 letters...
Phrases (150)
high reliefcoffee ringfield judgegentle windenergy unitgenus abiesmusic genregreek deitysui generisivy leaguer
...View all with 10 letters...
Words (1520)
interestingintelligentthreateningforgivenessinvestigatecelebratingmeaninglessengineeringrememberinginterferingprogressiveeverlastinginterrogategeneticallyproceedingsheavyweightenlightenedsightseeingsovereigntyfirefighterbourgeoisiepenetratingdeterminingexceedinglysegregationgingerbreadlegislatureprerogativemesmerizingsafekeepinglegislativebelligerentpoltergeistkierkegaardrenegotiate
...View all with 11 letters...
Phrases (255)
genus myxinegenus bletiameat grinderdiego riverain agreementgenus perdixsee the lightsingle entrygenus pernislittle grebe
...View all with 11 letters...
Words (1419)
intelligencerefrigeratorkindergartenentertainingoverwhelmingexperiencinginvestigatedexaggeratingcheerleadingmichelangeloillegitimateinterrogatedextinguishersleepwalkingdisagreementextinguishedacceleratinghousekeepingaggressivelyexaggerationrecognizableenlighteningregenerationinterpretingmagnificencedisagreeableredecoratingdisintegrateoverpoweringtriglycerideracketeeringdegenerativeinfringementrefrigeratedmiddleweight
...View all with 12 letters...
Phrases (425)
alec guinnessgrain cleanerjan tinbergengenus glycinesponge filterhead coveringwetting agentmeeting placelittle fingergenus encelia
...View all with 12 letters...
Words (1142)
enlightenmentrighteousnessinvestigativeeavesdroppingcondescendingheartbreakinginterestinglystrengtheningdeterioratingprogressivelyuninterestingdisintegratedrefrigerationmeteorologistintelligentlyundercarriageargumentativebutterfingersexterminatingeverlastinglyexteriorizingnecessitatingunintelligentexsanguinatedcrossbreedingcounterweighttelemarketingfeatherweightreintegrationbiodegradableindefatigableenergeticallygeneralissimoreverberatinghousecleaning
...View all with 13 letters...
Phrases (561)
might-have-beenbelgian endivebreathing timegenus cricetusline engravinglouis the greatsummit meetingwalter raleighfellow feelingget the picture
...View all with 13 letters...
Words (868)
unintelligibleoverwhelminglyunrecognizableaggressivenessmeteorologicalcytogeneticistelectroplatingmountaineeringintelligentsiadisembowellingnitroglycerineepidemiologistreconnoiteringdepigmentationgeneralizationweightlessnessunrefrigeratedunderachievingnonthreateningfortunetellingfredericksburgunrecognisablediscouragementgeneralisationoverestimatingaggrandizementtelangiectasiareexperiencingentertaininglydemythologisedunenlighteningtergiversationmeaningfulnessfarsightednessneighborliness
...View all with 14 letters...
Phrases (642)
galileo galileinegeri sembilanpier luigi nervigarageman's liengelatin dessertkissing diseasepaleolithic agebreathing placenoachian delugebreathing space
...View all with 14 letters...
Words (591)
electromagneticcinematographerunderprivilegedanaesthesiologyinterchangeableflibbertigibbetintercollegiatespermatogenesisparthenogenesisinconveniencingdifferentiatingmeaninglessnesscounterweightedcondescendinglyforesightednessgloucestershiregastroenteritisgentlemanlinessunrighteousnessreinvestigatingrematerializinglightheadednessdematerializingnearsightednessepidemiologicalinterrogatoriesheartbreakinglyuncomprehendingunprepossessingepistemologicalinterrogativelychurrigueresquetightfistednessprestigiousnessprogressiveness
...View all with 15 letters...
Phrases (654)
measuring devicefalco peregrinusbenefit of clergyoutside marriagehigh renaissancecapital of greecegenus potentillaalectoris graecasuperior generalbelgian shepherd
...View all with 15 letters...
Words (208)
anesthesiologistelectromagnetismshortsightednesscountersignaturehyperintelligentcounterespionagephylogeneticallyelectromagneticsteleconferencinglightheartednessspectroheliogramdisentanglementshypersensitizingmicrogametophyteantitechnologiesingloriousnessesthermoregulatingunneighborlinessingressivenessesthermoregulationdimethylglyoximehyperventilatingcounterweightingroentgenographicfarsightednessespartridgeberriesweatherstrippingfeatherstitchingjungermanniaceaerechoreographingsprightfulnesseslyginopteridalesfigurativenessesinextinguishablecurmudgeonliness
...View all with 16 letters...
Phrases (620)
multiengine planecartridge ejectorgenus angiopteriscartridge removerdefinite integralcovering materialgenus periplanetagenus proboscideaorder of magnitudetender loving care
...View all with 16 letters...
Words (134)
counterinsurgencyintergovernmentalelectrocardiogramintellectualizingcountersignaturessuperintelligencespectroheliogramsunexchangeabilityspectroheliographcounterstrategiescounterstrategistunmitigatednessescountersuggestionlepidopterologistthermoregulationsradiotelegraphiesdisgracefulnessesicelandic-speakinglepidopterologiesunrighteousnessestightfistednessesferrimagneticallymorphogeneticallyoutward-developingignominiousnessesrecognizabilitieslongsightednessesantireligiousnessimaginativenessesreconceptualizingcerebromeningitiscytomegalovirusesindefatigablenessmultigenerationaltransgenerational
...View all with 17 letters...
Phrases (577)
object recognitioncompetence hearinggenus globicephalacivil rights leadermespilus germanicanikolaas tinbergenhypoglycemic agentinterstate highwaypearly everlastingmiguel de cervantes
...View all with 17 letters...
Words (82)
gastroenterologistinterchangeabilityinexpugnablenessesunintelligiblenessspectroheliographscounterstrategistsspectroheliographycountersuggestionsknowledgeabilitiesdisingenuousnessessphygmomanometrieslepidopterologicallepidopterologistsrechromatographieslightheartednessescurmudgeonlinessesstereophotographicstereoregularitiesvaingloriousnesseslacto-vegetarianismvideoconferencingsimmunohematologiesmagnetoresistancesintelligiblenessesmagnetostrictivelyechocardiographersphenomenologicallyechocardiographiesgastroenterologiesgedankenexperimentgeneralizabilitieselectrocardiogramsbiodegradabilitieselectrocorticogramneuroendocrinology
...View all with 18 letters...
Phrases (522)
double-deck carriageprofessional golferedgar rice burroughstheodore dwight weldgeorge michael cohantheodosius the greatelaeagnus latifoliainterior decoratingrefrigerator cookiefamily asparagaceae
...View all with 18 letters...
Words (46)
counterintelligenceunintelligibilitiesparthenogeneticallyencephalomeningitisstereophotographiescytopathogenicitiesgastroenterologicalgastroenterologistsgedankenexperimentsprefigurativenessesgentlemanlikenesseselectrocardiographselectrocorticogramsneuropharmacologieselectromagneticallyelectrometallurgiesmeningoencephaliticelectronegativitiesmeningoencephalitiselectrophotographicelectrophysiologieselectrophysiologistovercommercializingelectroretinographselectroretinographyultrasegregationistcounteradvertisingsgood-neighbourlinessovergeneralizationsindefatigablenessesmicrometeorologicalmicrometeorologistshydrometeorologicalmicropaleontologieshydrometeorologists
...View all with 19 letters...
Phrases (398)
measuring instrumentaquilegia canadensisrejoicing over the lawcollective agreementalpine type of glaciergiles lytton stracheymeat-packing businesspierre-auguste renoirhandle with kid glovesorganization expense
...View all with 19 letters...
Words (22)
unintelligiblenessesspectroheliographiespolyphiloprogenitiveinterchangeabilitiesphiloprogenitivenessglomerulonephritidesneuroendocrinologiesneuroendocrinologistelectrooculographieselectrophotographieselectrophysiologicalelectrophysiologistselectroretinographicultrasegregationistsroentgenographicallyuncompromisingnessescounterdemonstratingsyncategorematicallyhypercoagulabilitiesnephroangiosclerosiscounterintelligenceselectrocardiographicPhrases (302)
sweet-scented geraniumarcheological remainsallium cepa aggregatumgilbert charles stuartpast progressive tenseevergreen bittersweetbyelorussian languagesagittarius the archerscomberomorus regalisambrose gwinett bierce
...View all with 20 letters...
Words (12)
straightforwardnessesinterchangeablenesseselectrocardiographiesneuroendocrinologicalneuroendocrinologistsmeningoencephalitideselectromyographicallyelectroretinographiesoverintellectualizingantiferromagneticallyindistinguishablenessdisadvantageousnessesPhrases (290)
use of goods and servicesagglutinative languageadministrative hearinggasterosteus pungitiuselaeagnus augustifoliaspontaneous generationbillie jean moffitt kingstephen william hawkinginterlingual renditionliquefied petroleum gas
...View all with 21 letters...
Words (2)
philoprogenitivenesseselectrophysiologicallyPhrases (211)
gilbert keith chestertongregorian calendar monthtransient global amnesiaitalian vegetable marrowfoeniculum vulgare dulcefuture progressive tensehigh-density lipoproteinrepublic of guinea-bissauguatemalan monetary unitivan sergeevich turgenev
...View all with 22 letters...
Words (2)
electroencephalographicindistinguishablenessesPhrases (128)
gilbert and ellice islandsboeing b-52 stratofortresspharmacological medicinehippoglossus stenolepsisapium graveolens rapaceumcapital of papua new guineagottfried wilhelm leibnizbangladeshi monetary unitgroup pteridospermaphytatechnological revolution
...View all with 23 letters...
Words (3)
microgramma-piloselloideselectrocardiographicallyelectroencephalographiesPhrases (138)
carnegie mellon universitylowland burrowing treefrogpelham grenville wodehouseargyroxiphium sandwicenseunidentified flying objecttrip the light fantastic toecapture of fort ticonderogazollinger-ellison syndromebattle of the little bighornsir terence mervyn rattigan
...View all with 24 letters...
Phrases (83)
miguel de cervantes saavedradiamond wedding anniversaryfrancis scott key fitzgeraldbrassica oleracea gemmiferadistinguished service medalcentral intelligence agencymodest petrovich mussorgskyedmund john millington syngesecret intelligence serviceantonio allegri da correggio
...View all with 25 letters...
Phrases (75)
charlotte anna perkins gilmanfrances eliza hodgson burnettright atrioventricular valvebrassica oleracea gongylodespolicing and enforcement costhunting and gathering societyanton grigorevich rubinsteinmalignant neoplastic diseasepersonal information managersir charles scott sherrington
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (56)
nikita sergeyevich khrushchevgeorge percy aldridge graingeraleksandr sergeyevich pushkinoffice of management and budgetaugustus welby northmore puginco-operative republic of guyanabeta-adrenergic blocking agentnuclear regulatory commissiontricyclic antidepressant drugjames augustine aloysius joyce
...View all with 27 letters...
Phrases (52)
revolutionary people's strugglebusiness process reengineeringbureau of engraving and printingephippiorhynchus senegalensismarcus junius brutus the youngermicrosoft disk operating systembattles of lexington and concordcapital of serbia and montenegrodemocratic republic of the congofederal housing administration
...View all with 28 letters...
Phrases (29)
male internal reproductive organfriedrich wilhelm august froebeldisorganized type schizophreniaautomatic data processing systemsouth-central dravidian languagegiovanni pierluigi da palestrinareceived pronunciation languagehydrangea macrophylla hortensisautoclaved lightweight concretenational intelligence community
...View all with 29 letters...
Phrases (18)
reduced instruction set computingglutamic oxalacetic transaminasedepartment of energy intelligencerepublic of bosnia and herzegovinaaugust friedrich leopold weismanncomplex instruction set computingnontricyclic antidepressant drugesther hobart mcquigg slack morrishenri rene albert guy de maupassantsisters of st. michael the archangel
...View all with 30 letters...
Phrases (30)
bureau of intelligence and researchmarie louise elisabeth vigee-lebrunguiseppe fortunino francesco verdisidonie-gabrielle claudine colettediego rodriguez de silva y velazquezpalestine liberation organizationpalestinian popular struggle frontelectromotive drug administrationislamic great eastern raiders-frontgeorges eugene benjamin clemenceau
...View all with 31 letters...
Phrases (18)
african american vernacular englishpeople against gangsterism and drugsweakly interacting massive particlesergei aleksandrovich koussevitzkystraight-line method of depreciationrevolutionary justice organizationobject-oriented programing languagecercopithecus aethiops pygerythrusisidore auguste marie francois comtecockcroft-walton voltage multiplier
...View all with 32 letters...
Phrases (20)
linear-quadratic-gaussian controllermusical instrument digital interfaceinternational maritime organizationstandard generalized markup languageobject-oriented programming languageorganization of the oppressed on earthpityrogramma calomelanos aureoflavaelizabeth cleghorn stevenson gaskellprivilege against self incriminationgeneral agreement on tariffs and trade
...View all with 33 letters...
Phrases (22)
relational database management systemfederal national mortgage associationgeorge louis palmella busson du mauriernero claudius caesar drusus germanicusinterstitial cell-stimulating hormonefriedrich august kekule von stradonitzeuropean law enforcement organisationvena centralis glandulae suprarenalisfunctional magnetic resonance imaginghermann ludwig ferdinand von helmholtz
...View all with 34 letters...
Phrases (12)
revolutionary organization 17 novembercanadian security intelligence serviceimmaculate conception of the virgin marycockcroft and walton voltage multipliernational socialist german workers' partyimmigration and naturalization serviceanti-imperialist international brigadefederal law enforcement training centerballistic missile defense organizationsubacute sclerosing leukoencephalitis
...View all with 35 letters...
Phrases (10)
jakob ludwig felix mendelssohn-bartholdyangiotensin-converting enzyme inhibitorforeign intelligence surveillance courtnational geospatial-intelligence agencyalbert francis charles augustus emmanuelcriminal intelligence services of canadanatural language processing applicationtiberius claudius drusus nero germanicusdeclining balance method of depreciationunited states government printing officePhrases (7)
million floating point operations per secondbillion floating point operations per seconddefense reutilization and marketing servicedirectorate for inter-services intelligencegates of the arctic national park and preservebaron hermann ludwig ferdinand von helmholtzenzyme-linked-immunosorbent serologic assay