Words Containing: E,E,Y
(In Any Order)
There are 7,687 words,
6,420 phrases and
0 abbr's with
E,E,Y in.
Best Scoring Words With: E,E,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| exequy | 6 | 25 | nounn | |||||
noun • (now only in plural) Funeral rites. | ||||||||
| wheezy | 6 | 24 | adjectiveadj | |||||
adjective satellite • having a tone of a reed instrument • relating to breathing with a whistling sound | ||||||||
| enzymes | 7 | 21 | nounn | |||||
noun • any of several complex proteins that are produced by cells and act as catalysts in specific biochemical reactions | ||||||||
| vexedly | 7 | 21 | ||||||
Valid word for Scrabble US
| ||||||||
| jewelry | 7 | 20 | nounn | |||||
noun • an adornment (as a bracelet or ring or necklace) made of precious metals and set with gems (or imitation gems) | ||||||||
| enzyme | 6 | 20 | nounn | |||||
noun • any of several complex proteins that are produced by cells and act as catalysts in specific biochemical reactions | ||||||||
| breezy | 6 | 20 | adjectiveadj | |||||
adjective satellite • fresh and animated • abounding in or exposed to the wind or breezes | ||||||||
| veejays | 7 | 20 | verb, nounv, n | |||||
noun • Someone who presents a television programme of videos; a video jockey. • Vagina, vulva. | ||||||||
| jayvees | 7 | 20 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| epoxyed | 7 | 20 | verb, adjectivev, adj | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
eyeWords (346)
jewelrykennedydelayedseventyelderlydecencysceneryfreewayshelleysecrecyhygieneeyeballeyebrowsweetlypresleytherebyeagerlyrecyclebreweryhersheywherebyeyesorecayennekeyholeeyelashlayeredwembleydecayedweekdayregencymynheerdenselykeynotedempseyvelvety
...View all with 7 letters...
Phrases (20)
busy beeeye maskholy seegoat eyede bakeyfete daygrey henevil eyehome keykey lime
...View all with 7 letters...
Words (571)
everyoneanywhererecentlyeverydaydeliveryceremonyentirelycemeteryemployeeeternitysecretlyrecoveryheavenlyemployedseverelyemployertendencyeyesightremotelyberkeleyepilepsyserenitybetrayergeometryfiercelycheyennedecentlytypefacetenderlyseverityeyelinerrefinerysecurelycleverlyentirety
...View all with 8 letters...
Phrases (50)
zane greyvery wellegg yieldeye blinkeye candyeye toothken keseycaley peaby the byemagic eye
...View all with 8 letters...
Words (823)
everybodyyesterdaynecessaryemergencydestroyedperfectlysecretaryextremelywednesdaypreciselygenerallycelebritylifestylelegendaryfrequencysincerelymysteriesevidentlyjewellerynecessitydestroyergenuinelyseeminglyendlesslyallegedlyeternallypresentlyspeakeasyenjoyablemercenaryenjoymentblueberryintenselyexemplaryimmensely
...View all with 9 letters...
Phrases (127)
direct dyeitchy feetevery weekalex haleydyer's weedturkey legturkey redkey strokenew jerseyivy league
...View all with 9 letters...
Words (1018)
everythingcompletelydefinitelyespeciallyeverywhereeventuallyunemployedemploymentscreenplayelementarypeacefullyexcellencyrelativelyfrequentlyrepeatedlyseparatelygenerositytypewriterefficiencyeyewitnesspreferablypresidencyhopelesslyhereditaryhyperspacedehydrateddiscreetlydeploymentdeficiencyveterinarygenerouslystereotypesleepyheadinherentlyembroidery
...View all with 10 letters...
Phrases (222)
mary leakeyfleur-de-lysepoxy resinbrya ebenusprivate eyeby the pieceenergy unithoney eaterapple jellyemery cloth
...View all with 10 letters...
Words (1080)
immediatelyelectricitydifferentlynecessarilyessentiallydesperatelyunnecessarypermanentlygeneticallyeffectivelyexclusivelyheavyweightyellowstonesovereigntybeneficiarymercilesslyprematurelystorytellerexceedinglyregrettablyexcessivelyefficientlypsychedelichypermarketobjectivelyshamelesslysynthesizerhyperactivedelinquencycelebratoryextensivelyhuckleberryconfederacyperpetuallyattentively
...View all with 11 letters...
Phrases (304)
genus myxinelouis leakeysilver berryelinor wyliesystem errormary shelleyenergy levelroentgen rayhoney badgersingle entry
...View all with 11 letters...
Words (1063)
deliberatelyunemploymentunexpectedlychemotherapyunbelievablyindefinitelyrespectfullypenitentiaryencyclopediatremendouslyconsequentlyaggressivelysubsequentlydefinitivelycollectivelyconvenientlyrelentlesslyformaldehydeintermediarytriglyceridehypertensioneffortlesslyclytemnestraneurosurgeryhysterectomyrespectivelylegitimatelyelectrifyingperipherallypresbyterianincoherentlyelectricallypersistentlyrefreshinglytheophylline
...View all with 12 letters...
Phrases (356)
backspace keygenus glycineadmiral deweyread-only fileearnest moneyhockey leagueathletic typechinese deityfully fledgedwaste of money
...View all with 12 letters...
Words (845)
unnecessarilytheoreticallyexceptionallyindependentlyinterestinglyinadvertentlyprogressivelyexponentiallyintelligentlycomplementaryirretrievablyalternativelysupplementaryeverlastinglystereotypicalconsecutivelyexpeditionarybelievabilitynorthwesterlyaestheticallyimperceptiblyconfectioneryencyclopaediaindifferentlydehydrogenaseenergeticallyhydroelectricungentlemanlydependabilitycompetitivelyarchaeopteryxpredominatelyeccentricallysentimentallyhypercalcemia
...View all with 13 letters...
Phrases (436)
auditory senseneglect of dutyinventory itemarnold toynbeehydrated oxidespiny anteatersystem of rulesholy sepulcherholy sepulchreprivate treaty
...View all with 13 letters...
Words (685)
intellectuallywholeheartedlyaffectionatelyelectronicallyoverwhelminglysentimentalityrespectabilityhypersensitivecytogeneticistinterplanetaryundersecretarypancreatectomyelectrotherapyhyperventilatenitroglycerineintermittentlyconservativelychemosynthesisexperimentallymetempsychosistelepathicallyreproductivelygovernmentallyinconvenientlyencephalopathyappreciativelyappendicectomyelectromyogramintermediatelyentertaininglydifferentiallyendarterectomypyelonephritisinterferometrydepartmentally
...View all with 14 letters...
Phrases (478)
family apiaceaepearl mae baileyfield intensitybattle of nasebymoonseed familyorder mysidaceadimethyl ketonefamily ardeidaedrunken revelrynavy department
...View all with 14 letters...
Words (454)
environmentallyanaesthesiologydisrespectfullyheterosexualitydevelopmentallyintellectualityparentheticallyplenipotentiarycondescendinglymaneuverabilitytherapeuticallymethylphenidatestereochemistryencephalographyphotosynthesizepostoperativelyintrospectivelycholecystectomyuninterruptedlydemonstrativelyretrospectivelyunceremoniouslyheartbreakinglyunprecedentedlyinconsideratelyeuphemisticallycomprehensivelytemperamentallydiphenhydramineinterdependencyinterrogativelysymmetricalnessperpendicularlyoxytetracyclinekinesthetically
...View all with 15 letters...
Phrases (571)
stay of executioncentaurea cyanusbenefit of clergyclass pelecypodaalimentary pastehelen wills moodyebony spleenwortfamily lemnaceaeadvisory servicefamily arecaceae
...View all with 15 letters...
Words (209)
hemorrhoidectomyincomprehensiblytriphenylmethanehyperintelligenthyperventilationquintessentiallyphylogeneticallyimperceptibilityelectromyographysphygmomanometerextemporaneouslyelectrochemistryhypersensitivitypolydispersitiespolyelectrolytesheterokontophytahymenophyllaceaeexterritorialityparaformaldehydethermometricallyextracorporeallyhypersensitizingmicrogametophytenoncompetitivelyhypersexualitieshypersomnolencesimperfectibilityantiunemploymentthermoregulatoryhypersusceptibleapocryphalnessesdimethylglyoximehyperventilatinghyperviscositieshypervitaminoses
...View all with 16 letters...
Phrases (587)
hypodermic needletympanic membranein a beastly mannerfamily cyperaceaedefinite quantitywilliam wycherleyin an elaborate wayefficiency expertamerican sycamorecommercial agency
...View all with 16 letters...
Words (113)
counterinsurgencyperchloroethyleneelectrostaticallycontemporaneouslyinconsequentiallypsychotherapeutichyperreactivitiesisoelectronicallyphysiotherapeuticcercidiphyllaceaeunexchangeabilityparaformaldehydesthermoperiodicityspectrophotometryhyperventilationssphygmomanometerschlortetracyclinehypophysectomizeshypophysectomisedferrimagneticallymorphogeneticallyhypophysectomizedcryopreservationsencephalomyelitispentylenetetrazoldisrespectabilitylymphadenopathieshyperalimentationgastroenterostomycytomegalovirusesstereospecificitytrichloroethyleneimmunogeneticallyelectronegativitythiodiphenylamine
...View all with 17 letters...
Phrases (588)
dame margot fonteyngopherus polypemusmary leontyne pricebalaena mysticetusczech monetary unitproteolytic enzymemary mcleod bethunehypoglycemic agentinterstate highwaypearly everlasting
...View all with 17 letters...
Words (78)
inconsequentialityhyperaldosteronisminterchangeabilityhypersensitivenesspolyesterificationspectrofluorometrymethyltestosteronehypersensitivitieshypersensitizationelectrodynamometerspectroheliographypolyribonucleotidenoncomprehensivelypsychotherapeuticssphygmomanometriespentylenetetrazolscylindrical-stemmedperchloroethyleneshyperbilirubinemiastereospecificallypteridospermaphytadiethylmalonylureadiethylstilbestrolcounterintuitivelyhypercholesteremiasaccharomycetaceaemagnetostrictivelymyeloproliferativephenomenologicallyhydroflumethiazidedehydrochlorinasesdehydrochlorinateddehydrochlorinatesneuroendocrinologytrichloroethylenes
...View all with 18 letters...
Phrases (551)
family physeteridaedame sybil thorndikelachrymal secretionperomyscus leucopusjohn orley allen tateclass schizomycetesread-only memory chipkilocycle per secondfamily trichechidaesuperiority complex
...View all with 18 letters...
Words (54)
polyesterificationshypersensitizationspolyribonucleotidesextraterritorialityhypersusceptibilityparathyroidectomieshypolipoproteinemiaparthenogeneticallycytodifferentiationcytopathogenicitiesdiethylstilbesteroldiethylstilboestrolphenomenalisticallyphenylthiocarbamideechoencephalographymercury-contaminatedelectrodynamometersinterconvertibilityphosphoenolpyruvateinterdepartmentallyelectromagneticallyelectromechanicallyinterferometricallythree-dimensionalityelectrophoreticallymethylcholanthrenesmethylprednisoloneselectrophysiologieselectrophysiologistdeoxyribonucleotideelectroretinographyincomprehensibilitymicroelectronicallyencephalomyelitidesphenylpropanolamine
...View all with 19 letters...
Phrases (443)
family cyclopteridaeseventeen-year locustmillimeter of mercuryalpine type of glaciergiles lytton stracheyfamily lepisosteidaezairese monetary unitjacques yves cousteaunancy freeman mitfordfamily tropaeolaceae
...View all with 19 letters...
Words (27)
counterrevolutionaryhypercholesterolemiaoverenthusiasticallyhypersensitivenessespolyphiloprogenitiveparathyroidectomizedhyperadrenocorticismcytodifferentiationsphenylpropanolaminesphenylthiocarbamidesacetylcholinesterasephosphoenolpyruvateshyperlipoproteinemiaelectrophysiologicalelectrophysiologistsdeoxyribonucleotidesroentgenographicallyencephalomyocarditischemotherapeuticallypseudoparenchymatoussyncategorematicallyhypercholesterolemichypercoagulabilitieshyperconsciousnessesdimethylnitrosaminesheterobasidiomycetesexistentialisticallyPhrases (402)
william stanley jevonsyellow-shafted flickerwyethia amplexicaulisorder mycelia steriliafamily phytolaccaceaelebanese monetary unitorder myxobacterialesbalaenoptera physalusfamily trachipteridaedevelopmental anatomy
...View all with 20 letters...
Words (11)
hypersusceptibilitiesstereomicroscopicallyimmunocytochemistriesalkylbenzenesulfonateacetylcholinesterasesphosphoglyceraldehydeelectromyographicallypolyvinyl-formaldehydeantiferromagneticallyhypercholesterolemiaspsychotherapeuticallyPhrases (278)
icelandic monetary unitelectrolytic condenseraleksandr solzhenitsynhelichrysum bracteatumdesoxyribonucleic acidextrauterine pregnancybyzantine architecturepseudemys rubriventriseucalyptus fraxinoidesextremely low frequency
...View all with 21 letters...
Words (11)
pentamethylenetetrazolspectrophotometricallyintercomprehensibilityelectroencephalographyphosphoglyceraldehydescarboxymethylcelluloseelectrophysiologicallyhexamethylenetetramineencephalomyocarditisesdihydroxyphenylalaninemicrospectrophotometryPhrases (240)
venezuelan monetary unitlycopersicon esculentumhaliaeetus leucorhyphusredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynaccessory before the factfamily dendrocolaptidaemultiple mononeuropathy
...View all with 22 letters...
Words (4)
carboxymethylcellulosespolytetrafluoroethylenehexamethylenetetramineshypobetalipoproteinemiaPhrases (158)
family threskiornithidaegeorge macaulay trevelyanmeperidine hydrochlorideyellowstone national parkparis-sorbonne universityeuropean recovery programbangladeshi monetary unitsouth korean monetary unittyrosine kinase inhibitorrichard brinsley sheridan
...View all with 23 letters...
Words (5)
hyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolaminemicroelectrophoreticallyschizosaccharomycetaceaePhrases (127)
carnegie mellon universitylouis seymour bazett leakeyargyroxiphium sandwicensesubdivision deuteromycotadivision heterokontophytaunidentified flying objectprivately held corporationzollinger-ellison syndromeprimary sex characteristicsir terence mervyn rattigan
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (103)
myroxylon balsamum pereiraemary wollstonecraft shelleydiamond wedding anniversaryfrancis scott key fitzgeraldcentral intelligence agencymodest petrovich mussorgskyedmund john millington syngepropoxyphene hydrochloridemelanerpes erythrocephalusreligious society of friends
...View all with 25 letters...
Phrases (76)
brassica oleracea gongylodeshunting and gathering societyhuman immunodeficiency virussecretary of veterans affairsemployee stock ownership planevelyn arthur saint john waughassyrian neo-aramaic languagecharles maurice de talleyrandrevolutionary calendar monthnewton's theory of gravitation
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (60)
business environment analysisamerican revolutionary leadernikita sergeyevich khrushchevholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinorder of our lady of mount carmelaugustus welby northmore puginco-operative republic of guyanacommissioned military officer
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (48)
revolutionary people's strugglealeksandr feodorovich kerenskyephippiorhynchus senegalensistriphosphopyridine nucleotideoxytetracycline hydrochloridemarcus junius brutus the youngermicrosoft disk operating systemfeodor mikhailovich dostoevskydepartment of homeland securitymaster of arts in library science
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (34)
business environmental analysisaleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitedward george earle bulwer-lyttoninternational olympic committeemiddle east respiratory syndrome
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (31)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligenceethylenediaminetetraacetic acidbalance of international paymentswaterhouse-friderichsen syndrome
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (17)
freedom from involuntary servitude2019-ncov acute respiratory diseasetupac amaru revolutionary movementrevolutionary proletarian nucleusdiego rodriguez de silva y velazquezport-access coronary bypass surgeryrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyerinternational atomic energy agencymarie anne charlotte corday d'armont
...View all with 31 letters...
Phrases (19)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylateuniversity of california at berkeleytheory of electrolytic dissociation
...View all with 32 letters...
Phrases (15)
autonomous sensory meridian responselycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavaright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human serviceshighly active antiretroviral therapyinternational law enforcement agency
...View all with 33 letters...
Phrases (12)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesdryopithecus rudapithecus hungaricusmassachusetts institute of technologyerasable programmable read-only memoryeinstein's general theory of relativityeinstein's special theory of relativitygymnosporangium juniperi-virginianae
...View all with 34 letters...
Phrases (12)
communications security establishmentrevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence serviceimmaculate conception of the virgin maryhereditary motor and sensory neuropathynational socialist german workers' partydepartment of defense laboratory systemfraxinus pennsylvanica subintegerrima
...View all with 35 letters...
Phrases (8)
jakob ludwig felix mendelssohn-bartholdysecretary of state for the home departmentangiotensin-converting enzyme inhibitorchurch of jesus christ of latter-day saintsnational geospatial-intelligence agencyfield-sequential color television systemsecretary of health education and welfaresocialist people's libyan arab jamahiriyaPhrases (12)
severe combined immunodeficiency diseasefirst epistle of paul the apostle to timothyuniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentacademy of motion picture arts and scienceskarl friedrich hieronymus von munchhausendefense advanced research projects agency
...View all with 37 letters...
