Words Containing: E,E,N,Y
(In Any Order)
There are 3,747 words,
4,084 phrases and
0 abbr's with
E,E,N,Y in.
Best Scoring Words With: E,E,N,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| enzymes | 7 | 21 | nounn | |||||
noun • any of several complex proteins that are produced by cells and act as catalysts in specific biochemical reactions | ||||||||
| enzyme | 6 | 20 | nounn | |||||
noun • any of several complex proteins that are produced by cells and act as catalysts in specific biochemical reactions | ||||||||
| queenly | 7 | 19 | adverb, adjectiveadv, adj | |||||
adjective satellite • having the rank of or resembling or befitting a queen | ||||||||
| jeepney | 7 | 19 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| sneezy | 6 | 18 | adjectiveadj | |||||
adjective satellite • inclined to sneeze | ||||||||
| enjoyed | 7 | 18 | verbv | |||||
verb • derive or receive pleasure from; get enjoyment from; take pleasure in • have benefit from • get pleasure from • have for one's benefit • take delight in | ||||||||
| enjoyer | 7 | 17 | nounn | |||||
noun • a person who delights in having or using or experiencing something | ||||||||
| eyewink | 7 | 17 | verb, nounv, n | |||||
Valid word for Scrabble US
| ||||||||
| reenjoy | 7 | 17 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| xylenes | 7 | 17 | nounn | |||||
noun • a colorless flammable volatile liquid hydrocarbon used as a solvent | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (105)
kennedyseventydecencysceneryhygienecayenneregencymynheerdenselykeynotebeanerymycenaenureyevreentrywynettehoneyedmoneyedpinkeyespleenystyrenetenselyqueenlytoynbeesyenitegreenlymyelinemoneyerteentsyenzymesboneyeryearnedneedilyenjoyerneotenyneotype
...View all with 7 letters...
Phrases (3)
grey heneye banknew yearWords (190)
everyoneanywhererecentlyceremonyentirelyeternityheavenlytendencyserenitycheyennedecentlytenderlyeyelinerrefineryentiretygreeneryleniencykeystonepyreneesclemencykennellyunseemlynewlywedgreenwayhoneybeeeverymankerenskymontereyhoneydewfedayeenganymedeabeyanceunevenlyentreatyhegemony
...View all with 8 letters...
Phrases (14)
zane greyeye blinkeye candyken keseymay queennew pennymind's eyegreen baynew year'sone by one
...View all with 8 letters...
Words (349)
necessaryemergencywednesdaygenerallylegendaryfrequencysincerelyevidentlynecessitygenuinelyseeminglyendlesslyeternallypresentlyenjoyablemercenaryenjoymentintenselyimmenselyresidencydysenteryrepaymentjourneyedelegantlyearnestlyindecencygenealogyferventlyglycerinearchenemymonterreycentenarykeynesianacetylenemesentery
...View all with 9 letters...
Phrases (43)
new jerseyqueen cityreturn keyriver tynehenry lucejohn deweypenny antecoenzyme acoenzyme qbendy tree
...View all with 9 letters...
Words (475)
everythingdefinitelyeventuallyunemployedemploymentscreenplayelementaryexcellencyfrequentlygenerosityefficiencyeyewitnesspresidencydeploymentdeficiencyveterinarygenerouslyinherentlyexpectancyneedlesslynegativelydependencyunderbellyexternallyeloquentlycyberneticvehementlyhypotenuseconverselymoneymakersynecdochesynthesizecompetencyindecentlyepicondyle
...View all with 10 letters...
Phrases (95)
epoxy resinbrya ebenusenergy unithoney eateraniline dyeyemeni rialready moneyjohn wesleykey patternmetal money
...View all with 10 letters...
Words (548)
differentlynecessarilyessentiallyunnecessarypermanentlygeneticallyyellowstonesovereigntybeneficiaryexceedinglyefficientlysynthesizerdelinquencyextensivelyconfederacyattentivelygentlemanlydeuteronomyeventualitymoneylenderhoneysuckleserendipityevidentiarysedimentaryequivalencydeliverymanpolystyreneintensivelysynesthesiaexcellentlyinteragencysynthesizedcontentedlydefensivelyoffensively
...View all with 11 letters...
Phrases (138)
genus myxineelinor wylieenergy levelroentgen rayhoney badgersingle entryfree-and-easyledger entryaeolian lyrelevy en masse
...View all with 11 letters...
Words (537)
unemploymentunexpectedlyunbelievablyindefinitelypenitentiaryencyclopediatremendouslyconsequentlysubsequentlydefinitivelyconvenientlyrelentlesslyintermediaryhypertensionclytemnestraneurosurgeryelectrifyingpresbyterianincoherentlypersistentlyrefreshinglytheophyllinehypertensiveunemployableeccentricityinadequatelyinefficiencyappendectomyphenomenallybelligerencyphylogeneticinfrequentlyextrasensoryunreservedlypolyurethane
...View all with 12 letters...
Phrases (190)
genus glycineread-only fileearnest moneychinese deitywaste of moneyhoneyed wordstreasury notelienal arteryyenisey rivergenus apteryx
...View all with 12 letters...
Words (468)
unnecessarilyexceptionallyindependentlyinterestinglyinadvertentlyexponentiallyintelligentlycomplementaryalternativelysupplementaryeverlastinglyconsecutivelyexpeditionarynorthwesterlyconfectioneryencyclopaediaindifferentlydehydrogenaseenergeticallyungentlemanlydependabilitypredominatelyeccentricallysentimentallydeoxygenationinsensitivelyadrenalectomyincompetentlyineffectuallyinefficientlyexistentiallyceremoniouslyinexpensivelyunrelentinglymeaninglessly
...View all with 13 letters...
Phrases (257)
auditory senseneglect of dutyinventory itemarnold toynbeespiny anteateralan jay lernerjekyll and hydewaste of energycooley's anemiaacrylate resin
...View all with 13 letters...
Words (404)
intellectuallyaffectionatelyelectronicallyoverwhelminglysentimentalityhypersensitivecytogeneticistinterplanetaryundersecretarypancreatectomyhyperventilatenitroglycerineintermittentlyconservativelychemosynthesisexperimentallygovernmentallyinconvenientlyencephalopathyappendicectomyintermediatelyentertaininglydifferentiallyendarterectomypyelonephritisinterferometrydepartmentallymysteriousnesstelephonicallypreferentiallychemosyntheticanesthesiologyextortionatelyoverpoweringlypreponderantly
...View all with 14 letters...
Phrases (273)
field intensitybattle of nasebymoonseed familydimethyl ketonedrunken revelrynavy departmentemergency brakecooley's anaemiablended whiskeycanterbury bell
...View all with 14 letters...
Words (281)
environmentallyanaesthesiologydevelopmentallyintellectualityparentheticallyplenipotentiarycondescendinglymaneuverabilitymethylphenidateencephalographyphotosynthesizeintrospectivelyuninterruptedlydemonstrativelyunceremoniouslyheartbreakinglyunprecedentedlyinconsideratelycomprehensivelytemperamentallydiphenhydramineinterdependencyinterrogativelysymmetricalnessperpendicularlyoxytetracyclinekinestheticallyhypersensitizedcentrosymmetricinteruniversitysemidocumentaryheterogeneouslyunadulteratedlycontemplativelycomplementarity
...View all with 15 letters...
Phrases (352)
stay of executioncentaurea cyanusbenefit of clergyalimentary pastehelen wills moodyebony spleenwortfamily lemnaceaewassily leontiefspiny-headed wormerlenmeyer flask
...View all with 15 letters...
Words (121)
incomprehensiblytriphenylmethanehyperintelligenthyperventilationquintessentiallyphylogeneticallysphygmomanometerextemporaneouslyhypersensitivityheterokontophytahymenophyllaceaehypersensitizingnoncompetitivelyhypersomnolencesantiunemploymentapocryphalnesseshyperventilatinghypervitaminosesperpendicularitycryopreservationlyginopteridalesstereophonicallygastroenterologycyclohexylaminesoxyphencycliminekinaestheticallycytotechnologiesunrespectabilityoligodendrocytesconsequentialitymysteriousnessesphenylethylaminephenylketonuriasphenylketonuricsgeneralizability
...View all with 16 letters...
Phrases (380)
hypodermic needletympanic membranein a beastly mannerdefinite quantityin an elaborate wayefficiency expertamerican sycamorecommercial agencybattle of the boynefamily balaenidae
...View all with 16 letters...
Words (71)
counterinsurgencyperchloroethylenecontemporaneouslyinconsequentiallyisoelectronicallyunexchangeabilityhyperventilationssphygmomanometerschlortetracyclineferrimagneticallymorphogeneticallycryopreservationsencephalomyelitispentylenetetrazollymphadenopathieshyperalimentationgastroenterostomytrichloroethyleneimmunogeneticallyelectronegativitythiodiphenylaminephenylethylamineselectroanalyticalnephelometricallydehydrochlorinasesamoyedic-speakingdehydrochlorinatetriphenylmethaneshyperintelligenceaerothermodynamicneurophysiologiesneuropsychiatriesneuropsychologiesmesembryanthemumsmethylnaphthalene
...View all with 17 letters...
Phrases (399)
dame margot fonteynmary leontyne pricebalaena mysticetusczech monetary unitproteolytic enzymemary mcleod bethunehypoglycemic agentinterstate highwaypearly everlastingcylinder separator
...View all with 17 letters...
Words (58)
inconsequentialityhyperaldosteronisminterchangeabilityhypersensitivenesspolyesterificationmethyltestosteronehypersensitivitieshypersensitizationelectrodynamometerpolyribonucleotidenoncomprehensivelysphygmomanometriespentylenetetrazolscylindrical-stemmedperchloroethyleneshyperbilirubinemiadiethylmalonylureacounterintuitivelymagnetostrictivelyphenomenologicallydehydrochlorinasesdehydrochlorinateddehydrochlorinatesneuroendocrinologytrichloroethylenesgranulocytopoiesespolypropenonitrileaerothermodynamicsrepresentationallymethylcholanthreneheavyheartednessesmethylnaphthalenesmethylprednisolonedeoxyribonucleasespropertylessnesses
...View all with 18 letters...
Phrases (351)
dame sybil thorndikelachrymal secretionjohn orley allen tateread-only memory chipkilocycle per secondmegacycle per secondfulminate of mercurygenus chamaecytisusfamily loranthaceaeyemeni monetary unit
...View all with 18 letters...
Words (39)
polyesterificationshypersensitizationspolyribonucleotideshypolipoproteinemiaparthenogeneticallycytodifferentiationcytopathogenicitiesphenomenalisticallyphenylthiocarbamideechoencephalographymercury-contaminatedelectrodynamometersinterconvertibilityphosphoenolpyruvateinterdepartmentallyelectromagneticallyelectromechanicallyinterferometricallythree-dimensionalitymethylcholanthrenesmethylprednisolonesdeoxyribonucleotideelectroretinographyincomprehensibilitymicroelectronicallyencephalomyelitidesphenylpropanolaminehydroxytetracyclinetetrachloroethylenetetrafluoroethyleneoverproportionatelydiethylcarbamazineshyperconcentrationstetramethyldiarsinedimethylnitrosamine
...View all with 19 letters...
Phrases (301)
seventeen-year locustalpine type of glaciergiles lytton stracheyzairese monetary unitnancy freeman mitfordchinese monetary unitcost-benefit analysissubfamily mephitinaetheory of inheritancejapanese honeysuckle
...View all with 19 letters...
Words (19)
counterrevolutionaryoverenthusiasticallyhypersensitivenessespolyphiloprogenitivehyperadrenocorticismcytodifferentiationsphenylpropanolaminesphenylthiocarbamidesacetylcholinesterasephosphoenolpyruvateshyperlipoproteinemiadeoxyribonucleotidesroentgenographicallyencephalomyocarditispseudoparenchymatoussyncategorematicallyhyperconsciousnessesdimethylnitrosaminesexistentialisticallyPhrases (269)
william stanley jevonslebanese monetary unitbalaenoptera physalusdevelopmental anatomybalance sheet analysisbyelorussian languagebenjamin henry latrobeuniversity of nebraskamilton snavely hersheymagnetic bubble memory
...View all with 20 letters...
Words (5)
immunocytochemistriesalkylbenzenesulfonateacetylcholinesterasespolyvinyl-formaldehydeantiferromagneticallyPhrases (189)
icelandic monetary unitelectrolytic condenseraleksandr solzhenitsyndesoxyribonucleic acidextrauterine pregnancybyzantine architecturepseudemys rubriventriseucalyptus fraxinoidesextremely low frequencynorwegian monetary unit
...View all with 21 letters...
Words (6)
pentamethylenetetrazolintercomprehensibilityelectroencephalographyhexamethylenetetramineencephalomyocarditisesdihydroxyphenylalaninePhrases (176)
venezuelan monetary unitlycopersicon esculentumredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynfamily dendrocolaptidaemultiple mononeuropathyloyalist volunteer forcehigh-density lipoprotein
...View all with 22 letters...
Words (3)
polytetrafluoroethylenehexamethylenetetramineshypobetalipoproteinemiaPhrases (124)
family threskiornithidaegeorge macaulay trevelyanmeperidine hydrochlorideyellowstone national parkparis-sorbonne universityeuropean recovery programbangladeshi monetary unitsouth korean monetary unittyrosine kinase inhibitorrichard brinsley sheridan
...View all with 23 letters...
Words (2)
hyperbetalipoproteinemiaphosphatidylethanolaminePhrases (104)
carnegie mellon universityargyroxiphium sandwicensesubdivision deuteromycotadivision heterokontophytaunidentified flying objectprivately held corporationzollinger-ellison syndromesir terence mervyn rattiganalexandre emile jean yersinfluoxetine hydrocholoride
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (88)
myroxylon balsamum pereiraemary wollstonecraft shelleydiamond wedding anniversaryfrancis scott key fitzgeraldcentral intelligence agencyedmund john millington syngepropoxyphene hydrochloridemelanerpes erythrocephalusreligious society of friendsbeggar-my-neighbour strategy
...View all with 25 letters...
Phrases (62)
brassica oleracea gongylodeshunting and gathering societyhuman immunodeficiency virussecretary of veterans affairsemployee stock ownership planevelyn arthur saint john waughassyrian neo-aramaic languagecharles maurice de talleyrandrevolutionary calendar monthnewton's theory of gravitation
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (50)
business environment analysisamerican revolutionary leadernikita sergeyevich khrushchevholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinorder of our lady of mount carmelaugustus welby northmore puginco-operative republic of guyanacommissioned military officer
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (44)
revolutionary people's strugglealeksandr feodorovich kerenskyephippiorhynchus senegalensistriphosphopyridine nucleotideoxytetracycline hydrochloridemarcus junius brutus the youngermicrosoft disk operating systemdepartment of homeland securitymaster of arts in library sciencedissident irish republican army
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (32)
business environmental analysisaleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitedward george earle bulwer-lyttoninternational olympic committeemiddle east respiratory syndrome
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (29)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligenceethylenediaminetetraacetic acidbalance of international paymentswaterhouse-friderichsen syndrome
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (16)
freedom from involuntary servitude2019-ncov acute respiratory diseasetupac amaru revolutionary movementrevolutionary proletarian nucleusport-access coronary bypass surgeryrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyerinternational atomic energy agencymarie anne charlotte corday d'armontinternational intelligence agency
...View all with 31 letters...
Phrases (17)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovuniversity of california at berkeleytheory of electrolytic dissociationyevgeni aleksandrovich yevtushenkotyrannus domenicensis domenicensis
...View all with 32 letters...
Phrases (15)
autonomous sensory meridian responselycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavaright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human serviceshighly active antiretroviral therapyinternational law enforcement agency
...View all with 33 letters...
Phrases (12)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesdryopithecus rudapithecus hungaricusmassachusetts institute of technologyerasable programmable read-only memoryeinstein's general theory of relativityeinstein's special theory of relativitygymnosporangium juniperi-virginianae
...View all with 34 letters...
Phrases (12)
communications security establishmentrevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence serviceimmaculate conception of the virgin maryhereditary motor and sensory neuropathynational socialist german workers' partydepartment of defense laboratory systemfraxinus pennsylvanica subintegerrima
...View all with 35 letters...
Phrases (8)
jakob ludwig felix mendelssohn-bartholdysecretary of state for the home departmentangiotensin-converting enzyme inhibitorchurch of jesus christ of latter-day saintsnational geospatial-intelligence agencyfield-sequential color television systemsecretary of health education and welfaresocialist people's libyan arab jamahiriyaPhrases (11)
severe combined immunodeficiency diseaseuniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentacademy of motion picture arts and scienceskarl friedrich hieronymus von munchhausendefense advanced research projects agencysixteen personality factor questionnaire
...View all with 37 letters...
