Words Containing: E,E,N,A,N
(In Any Order)
There are 5,318 words,
6,271 phrases and
0 abbr's with
E,E,N,A,N in.
Best Scoring Words With: E,E,N,A,N
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| annexed | 7 | 15 | verbv | |||||
noun • an addition that extends a main building verb • take (territory) as if by conquest • add an extra part to | ||||||||
| annexes | 7 | 14 | verb, nounv, n | |||||
noun • an addition that extends a main building | ||||||||
| reannex | 7 | 14 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| annexe | 6 | 13 | verb, nounv, n | |||||
noun • an addition that extends a main building | ||||||||
| kneepan | 7 | 13 | nounn | |||||
noun • a small flat triangular bone in front of the knee that protects the knee joint | ||||||||
| enhance | 7 | 12 | verbv | |||||
verb • increase the level of • make better or more attractive | ||||||||
| cayenne | 7 | 12 | nounn | |||||
noun • plant bearing very hot and finely tapering long peppers; usually red • ground pods and seeds of pungent red peppers of the genus Capsicum • a long and often twisted hot red pepper | ||||||||
| henbane | 7 | 12 | nounn | |||||
noun • poisonous fetid Old World herb having sticky hairy leaves and yellow-brown flowers; yields hyoscyamine and scopolamine | ||||||||
| penance | 7 | 11 | nounn | |||||
noun • remorse for your past conduct • a Catholic sacrament; repentance and confession and atonement and absolution • voluntary self-punishment in order to atone for some wrongdoing | ||||||||
| hennaed | 7 | 11 | verb, adjectivev, adj | |||||
noun • a reddish brown dye used especially on hair verb • apply henna to one's hair | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (37)
canteenenhancepenancecayenneanemonecezanneneonateensnaregehennahenbaneuneatenadenineenplanehennaednankeenkneepanannexedannexesenneadsreannexrennasepennamepangeneneatenspennatenovenaepentaneenamineennagesnancerenarceenbawneenmayenneenrangesenecan
...View all with 7 letters...
Phrases (2)
nan heelpen nameWords (103)
entranceandersenenhancedmanneredendangervenetiannazarenegangreneantennaemeannessunbeatenardennesentangleensnaredneatnessenhancermenanderwannabeerevenantnarceinenearnessunearnedtendancesanenessmenhadenleannessnascenceencaeniabiennaleensnarescayennedcayennespennatedremanentneonates
...View all with 8 letters...
Phrases (5)
jan steennew havenin one earnota beneinner earWords (254)
gentlemandefendantpermanentvalentineentertainvengeanceamendmentenchantedcantonesephenomenaendurancegreenlandentangledresonancetangerineweakeningatonementdeafeningakhenatendemeaningendearingnakednessdependantchanneledmezzanineenactmententrancedperennialrepentantmanganeseuntenableinsensatecentenaryenunciatenewsagent
...View all with 9 letters...
Phrases (27)
in earnestlena horneguinea henpenny antegiven nameearned runnoble canerenal veingenus nepasnake fern
...View all with 9 letters...
Words (467)
lieutenantgenerationunderneathmanagementengagementadrenalinecopenhagenattendanceendangeredphenomenalabstinencedescendantgeneratingunattendedrepentanceunansweredundeniableunfastenedsustenancevenezuelangovernanceentrapmentembankmentvenerationincineratequeenslandpermanencecondensateendearmentuneasinessuntalentedpreplannedencampmentnewfangledcentennial
...View all with 10 letters...
Phrases (98)
aniline dyesnake venomedmund keanedna o'brienbase runnertable linenlean-to tentanne brontenail enamelanne sexton
...View all with 10 letters...
Words (642)
concentratethreateningarrangementmaintenancemeaninglesssentimentalunnecessaryinheritancepermanentlydescendantsrenaissanceentertainednetherlandsneanderthalentertainerpenetratingclandestinecleanlinessincineratedadvancementcountenanceunexplainedenchantmentintoleranceinnumerableexponentialstrangenessenhancementreincarnatereenactmentalexandrineextenuatingenslavementgentlemanlynecromancer
...View all with 11 letters...
Phrases (135)
bean counterin agreementtalent agentroentgen raygenus nepetaurban centerurban legendanemone fishsteam enginegene linkage
...View all with 11 letters...
Words (797)
announcementpresentationkindergartenentertainingconcentratedunreasonablefrankensteinveterinarianpenitentiarygovernmentalregenerationtransferencemagnificenceinvulnerablesubterraneanapprehensionnortheasterndegenerationinterminableendangermentremunerationunchallengedfermentationtranscendentincandescentguaranteeingunmanageablereassignmentunrestrainedfrankincenserecognizanceconvalescentrejuvenationimpermanencenonessential
...View all with 12 letters...
Phrases (251)
athene noctuaalec guinnesssecond adventgenus anethumgrain cleanercarniolan beejan tinbergentenant farmerperoneal veinchinese anise
...View all with 12 letters...
Words (771)
entertainmentenvironmentaldeterminationmediterraneanunnecessarilyencouragementexterminationindispensableinconsiderateinconceivablequestionnaireinadvertentlyunexplainableexponentiallyconfederationexterminatingreinstatementnecessitatinginterpersonalunmentionableexsanguinatedreorientationreintegrationconvalescencenonsequentialhousecleaningnonnegotiableunconquerableindeterminateungentlemanlytranscendenceunconsecratedsentimentallydeoxygenationuncontestable
...View all with 13 letters...
Phrases (330)
genus vanellusbedside mannerbelgian endivefire insuranceline engravingarnold toynbeeturbinate boneseventh heavenspiny anteaterinverse secant
...View all with 13 letters...
Words (759)
recommendationinterpretationunderstandablerepresentationreconnaissanceunderstatementimplementationantidepressantunrecognizablesentimentalitynewspaperwomaninterplanetaryaforementionedunpleasantnessquintessentialtranscendentalmountaineeringnebuchadnezzarunquestionableintelligentsiainternationaleunmentionablesacknowledgmentdepigmentationcounterbalancegeneralizationpredestinationdecontaminatedunpreparednessunidentifiablesentimentalistbenzodiazepinearrondissementprearrangementunderachieving
...View all with 14 letters...
Phrases (456)
negeri sembilangenus pelecanusexpense accountgarageman's liennoachian delugegenus pennatulasurface tensionchanson de gesterenaissance manresistance unit
...View all with 14 letters...
Words (651)
experimentationacknowledgementenvironmentallyentrepreneurialdisenfranchisedinconsequentialinterchangeableunpronounceabledifferentiationmisapprehensionparthenogenesisdesensitizationdifferentiatingmeaninglessnessplenipotentiaryneoconservativeenfranchisementnonexperimentalgentlemanlinesscounterargumentreapportionmentundemonstrativereinvestigatingadventurousnessreconcentrationnearsightednessincommensurablereconsiderationcontemporaneousinconsideratelycounterbalancednongovernmentalsentimentalizedunderhandednesssupplementation
...View all with 15 letters...
Phrases (542)
avestan languagecentaurea cyanushigh renaissancegenus potentillaprivate nuisancealpine sunflowerbengali languagecentennial statebattle of ravennaencelia farinosa
...View all with 15 letters...
Words (311)
intercontinentalenvironmentalistneurotransmitterenvironmentalismcountersignaturetriphenylmethanerepresentationalcounterespionagehyperventilationquintessentiallyreinterpretationunreasonablenessdemineralizationovercompensationostentatiousnessinterpretationalinterventricularepiphenomenalismabsentmindednesspredeterminationunattractivenessundifferentiateddecentralizationunderachievementexternalisationscounterstatementexternalizationsdisdainfulnessesunmannerlinessesdisentanglementsunattainablenessantitechnologiesextraneousnessesunpleasantnessesantiunemployment
...View all with 16 letters...
Phrases (576)
tympanic membranemultiengine planemanihot esculentain a beastly mannergenus angiopterischelonian reptiledefinite integraldefinite quantityin an elaborate waynathaniel currier
...View all with 16 letters...
Words (218)
depersonalizationtelecommunicationmisinterpretationintergovernmentaltranscendentalismmisrepresentationintellectualizingcontemporaneouslyinconsequentiallytranscendentalistinappropriatenessuncomfortablenessinterrelationshipinterdepartmentalknowledgeablenesscountersignaturescounterstatementsunexchangeabilityinflammablenessesunmitigatednessesinformativenesseskindheartednessesobjectionablenesscommonplacenessesdisfranchisementsinheritablenesseshyperventilationsself-determinationdisintermediationicelandic-speakingfantasticalnessesinoperativenessesfashionablenessescrestfallennessesinscrutablenesses
...View all with 17 letters...
Phrases (592)
jacqueline cochrandame margot fonteynmary leontyne pricecompetence hearinglandscape gardenerczech monetary unitnikolaas tinbergenhandicapped personcenter of attentionhorned rattlesnake
...View all with 17 letters...
Words (122)
telecommunicationsinconsequentialitydisenfranchisementoverrepresentationinterchangeabilityinexpugnablenesseshypersensitizationmisinterpretationsinharmoniousnessesmisrepresentationsinhospitablenessesdishonorablenessesfaintheartednesseslandlubberlinessescommunicablenessesrambunctiousnessesunprofitablenessesunreasonablenessesapprehensivenessesdisintermediationsunrestrainednessesunseasonablenessespentachlorophenolspentylenetetrazolsnonrepresentativescounterbombardmentnonrevolutionariestranscendentalismstranscendentalistsvaingloriousnessesinsufferablenessessentimentalisationsentimentalizationpertinaciousnessesmagnetoresistances
...View all with 18 letters...
Phrases (513)
oceanites oceanicusamerican revolutionanamnestic reactionjohn orley allen taterenaissance revivalnathaniel hawthorneinterior decoratingsecond cranial nerveinterior decorationinterior department
...View all with 18 letters...
Words (100)
countertransferenceintellectualizationpneumoencephalogramdisenfranchisementshypersensitizationscountersurveillanceextraordinarinessesknowledgeablenessescommunicativenessesparthenogeneticallycompanionablenessesdispassionatenessescompassionatenessesinstantaneousnessesencephalomeningitiscomplementarinessesreconceptualizationresorcinolphthaleincounterdemonstratorcytodifferentiationobjectionablenessesphenomenalisticallyconsequentialnessesgedankenexperimentsgentlemanlikenessesreinstitutionalizedreinstitutionalizesmercury-contaminatedtridimensionalitiescontemplativenessesdeinstitutionalizedinterdepartmentallyadventuresomenessesdeinstitutionalizescontradictorinesses
...View all with 19 letters...
Phrases (453)
measuring instrumentaquilegia canadensisseventeen-year locustread between the lineszairese monetary unitshakespearean sonnetmeat-packing businessorganization expensecaesalpinia echinatadelusions of grandeur
...View all with 19 letters...
Words (36)
counterrevolutionaryparadichlorobenzeneskeratoconjunctivitescountersurveillancescountertransferencesunrepresentativenessunsatisfactorinessesreconceptualizationscounterdemonstrationcytodifferentiationsintellectualizationsphenylpropanolaminesinterchangeabilitiesrepresentationalismsrepresentationalistsrepresentativenessesinappreciativenessesanthropocentricitiesdepartmentalizationsincommensurabilitiesphotointerpretationsoverdifferentiationsroentgenographicallyinconsequentialitiesinconsiderablenessesantiestablishmentismphotoreconnaissancescounterdemonstratingcounterdemonstratorsunconscionablenessesindiscriminatenessesnephroangiosclerosisunderrepresentationsdimethylnitrosaminesirreconcilablenesses
...View all with 20 letters...
Phrases (402)
william stanley jevonssweet-scented geraniumpelecanus onocrotalusappendicular skeletonprofessional relationlebanese monetary unitmultilinear evolutionlunar excursion modulebusiness relationshipdevelopmental anatomy
...View all with 20 letters...
Words (18)
disestablishmentarianmultidimensionalitiesestablishmentarianismalkylbenzenesulfonateinterchangeablenessesneuroendocrinologicalcontemporaneousnessesmeningoencephalitidesarenaria-melanocephalacountercountermeasurecounterdemonstrationsoverintellectualizingantiferromagneticallyundemonstrativenessesindistinguishablenesscounterinterpretationunexceptionablenessesdisadvantageousnessesPhrases (345)
agglutinative languageadministrative hearingelimination tournamentsierra nevada mountainsfrances hodgson burnettexperimental conditionicelandic monetary unitaleksandr solzhenitsynspontaneous generationtelephone conversation
...View all with 21 letters...
Words (12)
counterrevolutionarieskeratoconjunctivitidespentamethylenetetrazolkeratoconjunctivitisesdisestablishmentariansunrepresentativenessesnonrepresentationalismhexamethylenetetraminecountercountermeasuresdihydroxyphenylalanineestablishmentarianismscounterinterpretationsPhrases (289)
venezuelan monetary unitgregorian calendar monthprunus persica nectarinatransient global amnesialeishmaniasis americanaaleksandr i. solzhenitsynjohn ronald reuel tolkienmultiple mononeuropathyteacher-student relationpeloponnesian peninsula
...View all with 22 letters...
Words (4)
nonrepresentationalismshexamethylenetetraminesoverintellectualizationindistinguishablenessesPhrases (199)
gilbert and ellice islandsparenthetical expressiontransient ischemic attacksecond battle of el alameinchlorpheniramine maleateto all intents and purposessubpoena ad testificandumyellowstone national parkparis-sorbonne universitylewis and clark expedition
...View all with 23 letters...
Words (2)
phosphatidylethanolamineoverintellectualizationsPhrases (195)
basque homeland and freedomcarnegie mellon universitylowland burrowing treefrogargyroxiphium sandwicensedivision heterokontophytasir terence mervyn rattiganfrancois auguste rene rodincapital of northern irelanddmitri ivanovich mendeleevhunting and gathering tribe
...View all with 24 letters...
Words (2)
phosphatidylethanolaminesantiestablishmentarianismPhrases (165)
count ferdinand von zeppelincluster of differentiation 4diamond wedding anniversarychemical weapons conventioncruel and unusual punishmentnational science foundationcentral intelligence agencyfast local internet protocolboris leonidovich pasternakwar of the spanish succession
...View all with 25 letters...
Phrases (112)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanfrances eliza hodgson burnettx-linked dominant inheritancebacon-lettuce-tomato sandwichnational institutes of healthpolicing and enforcement costalternanthera philoxeroidescorrectional rehabilitationhunting and gathering society
...View all with 26 letters...
Words (1)
ethylenediaminetetraacetatePhrases (76)
business environment analysispartial differential equationamerican revolutionary leaderaleksandr sergeyevich pushkinelectromechanical transduceroffice of management and budgetsolenostemon scutellarioidesaugustus welby northmore puginbeta-adrenergic blocking agentelectronic musical instrument
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (87)
interstate commerce commissionaleksandr feodorovich kerenskybureau of engraving and printingephippiorhynchus senegalensismarcus junius brutus the youngercommission on the status of womenbattles of lexington and concordcapital of serbia and montenegrofederal housing administrationludwig josef johan wittgenstein
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (72)
business environmental analysisbusiness interruption insurancesecond council of constantinoplealeksandr nikolayevich scriabinchemical decomposition reactionacrylonitrile-butadiene-styreneantisocial personality disordermale internal reproductive organnational volunteers associationdisorganized type schizophrenia
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (51)
valentina vladmirovna tereshkovaalexander isayevich solzhenitsynglutamic oxalacetic transaminaseself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligencecoluber constrictor flaviventrisjacques anatole francois thibaultvicomte ferdinand marie de lessepsethylenediaminetetraacetic acid
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (54)
bureau of intelligence and researchsecond epistle to the thessaloniansfreedom from involuntary servitudepetroselinum crispum neapolitanumguiseppe fortunino francesco verdiunited states department of defensetupac amaru revolutionary movementsidonie-gabrielle claudine coletteunited states trade representativefrances elizabeth caroline willard
...View all with 31 letters...
Words (1)
tetrabromo-phenolsulfonephthaleinPhrases (29)
nikolai andreyevich rimski-korsakovafrican american vernacular englishpeople against gangsterism and drugspatent and trademark office databasedepartment of the federal governmentweakly interacting massive particleintercontinental ballistic missilestraight-line method of depreciationrevolutionary justice organizationobject-oriented programing language
...View all with 32 letters...
Phrases (32)
linear-quadratic-gaussian controllermusical instrument digital interfaceautonomous sensory meridian responsebreach of trust with fraudulent intentinternational maritime organizationstandard generalized markup languagelycopersicon esculentum cerasiformeobject-oriented programming languageorganization of the oppressed on earthmusculus obliquus externus abdominis
...View all with 33 letters...
Phrases (31)
jacques francois fromental elie halevyrelational database management systemconfidential adviser-advisee relationchronic obstructive pulmonary diseasefederal national mortgage associationacademy of television arts and sciencesnero claudius caesar drusus germanicusinterstitial cell-stimulating hormonemusculus sphincter ductus pancreaticifriedrich august kekule von stradonitz
...View all with 34 letters...
Phrases (29)
national baseball hall of fame and museumnational technical information servicejohann christoph friedrich von schillercommunications security establishmentinternational development associationunited states postal inspection servicetadeusz andrzej bonawentura kosciuszkorevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation party
...View all with 35 letters...
Phrases (18)
center for disease control and preventionrank-difference correlation coefficientjakob ludwig felix mendelssohn-bartholdyangiotensin-converting enzyme inhibitorforeign intelligence surveillance courtnational geospatial-intelligence agencyfield-sequential color television systemfreedom from cruel and unusual punishmentalbert francis charles augustus emmanuelsecretary of health education and welfare
...View all with 36 letters...
Phrases (16)
severe combined immunodeficiency diseaseunited states declaration of independencetheodore roosevelt memorial national parkuniversity of north carolina at chapel hillattention deficit hyperactivity disordercentre for international crime preventiongenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentacademy of motion picture arts and sciences
...View all with 37 letters...
Phrases (8)
general certificate of secondary educationunited states government accounting officeobject-oriented database management systemdemocratic republic of sao tome and principeeconomic commission for asia and the far eastdepartment of housing and urban developmentadvanced research and development activityminimally invasive coronary bypass surgeryPhrases (11)
million floating point operations per secondbillion floating point operations per seconddefense reutilization and marketing serviceislamic jihad for the liberation of palestinedirectorate for inter-services intelligencerespiratory distress syndrome of the newborngates of the arctic national park and preservenucleoside reverse transcriptase inhibitorpopular front for the liberation of palestinebaron hermann ludwig ferdinand von helmholtz
...View all with 39 letters...
Phrases (10)
nicotinamide adenine dinucleotide phosphateminnesota multiphasic personality inventoryrevolutionary proletarian initiative nucleinational archives and records administrationprayer of azariah and song of the three childrenregents of the university of california v. bakkeinternational relations and security networkursulines of mary immaculate virgin of gandinofirst of october antifascist resistance grouptrillion floating point operations per secondPhrases (7)
pearson product-moment correlation coefficientarmy high performance computing research centerpaul ludwig von beneckendorff und von hindenburgbasal body temperature method of family planningdemocratic front for the liberation of palestinenon-nucleoside reverse transcriptase inhibitorbaron friedrich heinrich alexander von humboldtPhrases (8)
national oceanic and atmospheric administrationtransmission control protocol/internet protocolcooper union for the advancement of science and artfifth amendment to the united states constitutionfirst amendment to the united states constitutionarmenian secret army for the liberation of armeniamedical literature analysis and retrieval systeminternational society for krishna consciousnessPhrases (6)
abul-walid mohammed ibn-ahmad ibn-mohammed ibn-roshdassociation for the advancement of retired personsprayer of azariah and song of the three holy childrenconte alessandro giuseppe antonio anastasio voltafirst epistle of paul the apostle to the corinthiansunited states army criminal investigation commandPhrases (8)
international bank for reconstruction and developmentnineteenth amendment to the united states constitutionfourteenth amendment to the united states constitutionfood and agriculture organization of the united nationseighteenth amendment to the united states constitutionunited nations international children's emergency fundroyal society of london for improving natural knowledgeunited society of believers in christ's second appearing
