Words Containing: E,E,K,N,S,Y
(In Any Order)
There are 76 words,
230 phrases and
0 abbr's with
E,E,K,N,S,Y in.
Best Scoring Words With: E,E,K,N,S,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| enskyed | 7 | 15 | verb, adjectivev, adj | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
keynesWords (18)
hyperkineseshyperkinesiahoneysucklesmonkeyshinescytoskeletoncockeyednesshyperkinesiskaryokineseshoneysuckershoneysuckledkeynesianismpennywinklesalkalescencyladylikenessfernyticklesmusky-scentedpancake-stylekidney-shapedPhrases (10)
risky venturerhesus monkeyalfred kinseydenmark veseyhockey seasonkey signaturespider monkeynew york asternew york stategrease monkeyWords (1)
alkylbenzenesulfonatePhrases (12)
aleksandr solzhenitsynsoren aabye kierkegaardthomas kennerly wolfe jr.sir john cowdery kendrewpresident john f. kennedythin-leaved stringybarkgenus krypterophaneronaustralian honeysucklenew zealand honeysuckletake the bull by the horns
...View all with 21 letters...
Phrases (1)
employee stock ownership planPhrases (1)
technical analysis of stock trendsPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay
