Words Containing: E,E,G,N
(In Any Order)
There are 9,535 words,
7,671 phrases and
0 abbr's with
E,E,G,N in.
Best Scoring Words With: E,E,G,N
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
feezing | 7 | 20 | ||||||
Valid word for Scrabble US
| ||||||||
heezing | 7 | 20 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
expunge | 7 | 17 | verbv | |||||
verb • remove by erasing or crossing out or as if by drawing a line | ||||||||
lozenge | 7 | 17 | nounn | |||||
noun • a small aromatic or medicated candy • a dose of medicine in the form of a small pellet | ||||||||
jeeping | 7 | 17 | verbv | |||||
Valid word for Scrabble US
| ||||||||
agenize | 7 | 17 | verbv | |||||
verb • age or bleach flour with Agene (nitrogen trichloride) | ||||||||
keeking | 7 | 16 | ||||||
verb • To peek; peep. | ||||||||
jeering | 7 | 15 | verb, adjectivev, adj | |||||
noun • showing your contempt by derision adjective satellite • abusing vocally; expressing contempt or ridicule | ||||||||
exigent | 7 | 15 | adjectiveadj | |||||
adjective satellite • demanding attention • requiring precise accuracy | ||||||||
exogens | 7 | 15 | nounn | |||||
noun • flowering plant with two cotyledons; the stem grows by deposit on its outside | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
geneWords (292)
feelingeveningmeetinggeneralkeepingrevengeengagedfeedingseekinggenuinegeneticelegantgrenadeteenageweepingfleeinghygieneneglectgenesislineagesegmentpeelingenragedfreeinggentileangeredgenericenlargeavengedsenegalseemingteemingjeeringeugeniaavenger
...View all with 7 letters...
Phrases (13)
nest eggtent pege regionbe givensage henbone agegrey henend gameleg bonehedge in
...View all with 7 letters...
Words (639)
sleepingfeelingssergeantcheeringbleedingexchangenegativedesignedfreezinggenerousengineerenteringdesignerteenagereighteenbreedinggardenerspeedingregimentsteeringgreetingresignedsweepingeveningsgeneratelingerieunderagegenocidecreepingbeginnerderangedemerginggeniusesagreeinggenetics
...View all with 8 letters...
Phrases (24)
zane greygenus zeamine cagebee stingnut sedgenerve gasrenege ongene chipnear galein league
...View all with 8 letters...
Words (1106)
recognizeemergencygentlemanexpectingknowledgechallengeagreementguaranteebelievingrecognisegenerallynegotiatepassengerdefendingmessengerreceivingencourageforeignerlegendarygeneratorrepeatingreferringvengeancejudgementgreatnessreleasingrevealingscreeningexchangedneglectedsovereigndeceivingsqueezinggenuinelyseemingly
...View all with 9 letters...
Phrases (111)
genus crexline judgerange poleon averagemoss greengarden eggseeing redgenus acerhome rangesea tangle
...View all with 9 letters...
Words (1392)
everythinggovernmentgenerationfrightenedpretendingmanagementengagementrecognizedscreechingvegetarianguaranteeddevelopingdepressingrehearsingchallengedencouragedpercentagecopenhagenrefreshingrecoveringrecognisedgreenhousegenerositystrengthenendangeredallegianceingredientdegeneratedesignateddelegationexercisingrespectingchallengerproceedingvegetation
...View all with 10 letters...
Phrases (240)
skagen oddecoffee ringsponge cakegentle windenergy unitgenus vespadragon treealan seegerpress agentwage earner
...View all with 10 letters...
Words (1549)
interestingintelligentthreateningforgivenessinvestigatecelebratingarrangementmeaninglessengineeringrememberingacknowledgeinterferingeverlastinginterrogategeneticallyproceedingsenlightenedsightseeingsovereigntypenetratingdeterminingexceedinglysegregationgingerbreadmesmerizingsafekeepingbelligerentrenegotiatestrangenesspomegranateevangelicaloverbearingconvergencepaperhangeroverheating
...View all with 11 letters...
Phrases (403)
genus myxinegenus crambe's gravenhageskagens oddegenus bletiameat grinderdengue feverin agreementgenus perdixtalent agent
...View all with 11 letters...
Words (1433)
intelligencekindergartenentertainingoverwhelmingexperiencinginvestigatedexaggeratingcheerleadingmichelangelointerrogatedacknowledgedextinguishersleepwalkingdisagreementextinguishedacceleratinghousekeepingexaggerationgovernmentalrecognizableenlighteningregenerationstrengthenedinterpretinggreenskeepermagnificenceconglomerateredecoratingneurosurgeontogethernessdisintegrateoverpoweringracketeeringdegenerativeinfringement
...View all with 12 letters...
Phrases (628)
graham greenealec guinnessgenus anethumgrain cleanerarnold geselljan tinbergengeorge m. cohanget one's lumpsgenus glycinesponge filter
...View all with 12 letters...
Words (1139)
enlightenmentunforgettableencouragementrighteousnessinvestigativeeavesdroppingknowledgeablecondescendingheartbreakinginterestinglystrengtheningdeterioratinguninterestingdisintegratedmagnetosphereforgetfulnessrefrigerationundergraduateintelligentlyundercarriageargumentativebutterfingersexterminatingeverlastinglyexteriorizingnecessitatinggroundskeeperunintelligentexsanguinatedcrossbreedingcounterweighttelemarketingreintegrationoceanographerindefatigable
...View all with 13 letters...
Phrases (720)
genus blaberusmight-have-beenchelone glabraneglect of dutygenus vanellusczech languagebelgian endivebreathing timegenus cricetusline engraving
...View all with 13 letters...
Words (834)
unintelligibleoverwhelminglyunrecognizableaggressivenesscytogeneticistelectroplatingmountaineeringintelligentsiadisembowellingacknowledgmentnitroglycerinereconnoiteringdepigmentationgeneralizationweightlessnessunrefrigeratedprearrangementunderachievinggovernmentallynonthreateningfortunetellingunrecognisableunacknowledgeddiscouragementgeneralisationoutrageousnessoverestimatingaggrandizementtelangiectasiareexperiencingentertaininglyunenlighteningtergiversationmeaningfulnessfarsightedness
...View all with 14 letters...
Phrases (824)
basque languagenegeri sembilangenus pelecanuspier luigi nervigarageman's liengelatin dessertkissing diseasegenus blattellagenus sarcoptesbreathing place
...View all with 14 letters...
Words (566)
electromagneticcinematographeracknowledgementunderprivilegedanaesthesiologyinterchangeableintercollegiatespermatogenesisparthenogenesisinconveniencingdifferentiatingmeaninglessnesscounterweightedcondescendinglyforesightednessgastroenteritisgentlemanlinesscounterargumentencephalographyunrighteousnessreinvestigatingrematerializinglightheadednessdematerializingthoughtlessnessnearsightednessinterrogatoriesheartbreakinglyuncomprehendingnongovernmentalunchallengeableunprepossessinginterrogativelytightfistednessprestigiousness
...View all with 15 letters...
Phrases (796)
measuring deviceavestan languagefalco peregrinusbenefit of clergyhigh renaissancegenus potentillasuperior generalbelgian shepherdbengali languagegenus priodontes
...View all with 15 letters...
Words (217)
anesthesiologistelectromagnetismshortsightednesscountersignaturehyperintelligentcounterespionagephylogeneticallyelectromagneticssphygmomanometerteleconferencinglightheartednessdisentanglementshypersensitizingantitechnologiesingloriousnessesthermoregulatingunneighborlinessingressivenessesthermoregulationhyperventilatinglargeheartednessthoughtfulnessesrampageousnessescounterweightingcourageousnessesroentgenographicfarsightednessesweatherstrippingfeatherstitchingjungermanniaceaerechoreographingsprightfulnesseslyginopteridalescounterchallengefigurativenesses
...View all with 16 letters...
Phrases (759)
multiengine planegenus crassostreagenus elaeocarpusgenus angiopterishead cabbage plantto a greater extentdefinite integralhonest-to-goodnesscovering materialgenus periplaneta
...View all with 16 letters...
Words (120)
counterinsurgencyintergovernmentalintellectualizingknowledgeablenesscountersignaturessuperintelligenceunexchangeabilitycounterstrategiescounterstrategistunmitigatednessescountersuggestionthermoregulationsdisgracefulnessesthoughtlessnessessphygmomanometersicelandic-speakingunrighteousnessestightfistednessesferrimagneticallymorphogeneticallyoutward-developingignominiousnessesrecognizabilitieslongsightednessesantireligiousnessimaginativenessesreconceptualizinggastroenterostomycerebromeningitisindefatigablenessmultigenerationaltransgenerationalforesightednessesrecontextualizingimmunogenetically
...View all with 17 letters...
Phrases (664)
object recognitiondame margot fonteyncompetence hearinggenus globicephalalandscape gardenergenus ceratosaurusmespilus germanicanikolaas tinbergenhypoglycemic agentinterstate highway
...View all with 17 letters...
Words (71)
gastroenterologistinterchangeabilityinexpugnablenessesunintelligiblenesscounterstrategistscountersuggestionsknowledgeabilitiesdisingenuousnesseslargeheartednessessphygmomanometrieslightheartednessescurmudgeonlinessesvaingloriousnessesforethoughtfulnesslacto-vegetarianismvideoconferencingsimmunohematologiesmagnetoresistancesintelligiblenessesmagnetostrictivelyphenomenologicallygastroenterologiesgedankenexperimentgeneralizabilitiesechoencephalographneuroendocrinologyadvantageousnessesgranulocytopoiesesgreatheartednessesnoninterchangeablesuperconglomeratesunpleasant-smellingmethemoglobinemiasphotodisintegratedphotodisintegrates
...View all with 18 letters...
Phrases (566)
professional golfergeorge michael cohanelaeagnus commutataelaeagnus latifoliainterior decoratingottmar mergenthalergenus encephalartosgeorge simon kaufmanstar-spangled bannerpooecetes gramineus
...View all with 18 letters...
Words (38)
counterintelligencepneumoencephalogramunintelligibilitiesknowledgeablenessesparthenogeneticallyencephalomeningitiscytopathogenicitiesgastroenterologicalgastroenterologistsgedankenexperimentsprefigurativenessesgentlemanlikenessesechoencephalographyneuropharmacologieselectromagneticallymeningoencephaliticelectronegativitiesmeningoencephalitisovercommercializingheterogeneousnesseselectroretinographselectroretinographyultrasegregationistcounteradvertisingsgood-neighbourlinessovergeneralizationsindefatigablenessesmicropaleontologiesantiferromagnetismsethnomethodologistsinterchangeablenesscounterinsurgenciesovolactovegetarianspaleoanthropologiesdisadvantagednesses
...View all with 19 letters...
Phrases (396)
measuring instrumentaquilegia canadensisrejoicing over the lawcollective agreementalpine type of glaciergiles lytton stracheymeat-packing businesspierre-auguste renoirhandle with kid glovesorganization expense
...View all with 19 letters...
Words (17)
electroencephalogramunintelligiblenessespolyphiloprogenitiveforethoughtfulnessesinterchangeabilitiesphiloprogenitivenessglomerulonephritidesneuroendocrinologiesneuroendocrinologistelectroretinographicultrasegregationistsroentgenographicallyuncompromisingnessescounterdemonstratingsyncategorematicallynephroangiosclerosiscounterintelligencesPhrases (301)
sweet-scented geraniumarcheological remainspast progressive tenseevergreen bittersweetbyelorussian languageambrose gwinett bierceaugustin eugene scribeneisseria gonorrhoeaebarthold georg niebuhrgeorges henri lemaitre
...View all with 20 letters...
Words (12)
electroencephalographstraightforwardnessesinterchangeablenessesneuroendocrinologicalneuroendocrinologistselectroencephalogramsmeningoencephalitideselectroretinographiesoverintellectualizingantiferromagneticallyindistinguishablenessdisadvantageousnessesPhrases (277)
use of goods and servicesagglutinative languageadministrative hearingfrances hodgson burnettgasterosteus pungitiuselaeagnus augustifoliaspontaneous generationbillie jean moffitt kingstephen william hawkinginterlingual rendition
...View all with 21 letters...
Words (3)
philoprogenitivenesseselectroencephalographselectroencephalographyPhrases (205)
gilbert keith chestertongregorian calendar monthtransient global amnesiaschlumbergera truncatusitalian vegetable marrowfoeniculum vulgare dulcefuture progressive tensehigh-density lipoproteinrepublic of guinea-bissauguatemalan monetary unit
...View all with 22 letters...
Words (3)
electroencephalographicelectroencephalographerindistinguishablenessesPhrases (130)
gilbert and ellice islandsgeorge macaulay trevelyanboeing b-52 stratofortresspharmacological medicinegenus pseudopleuronecteshippoglossus stenolepsisapium graveolens rapaceumcapital of papua new guineaeuropean recovery programgottfried wilhelm leibniz
...View all with 23 letters...
Words (2)
electroencephalographerselectroencephalographiesPhrases (143)
carnegie mellon universitylowland burrowing treefrogpelham grenville wodehouseargyroxiphium sandwicenseunidentified flying objecttrip the light fantastic toecapture of fort ticonderogazollinger-ellison syndromebattle of the little bighornsir terence mervyn rattigan
...View all with 24 letters...
Phrases (83)
miguel de cervantes saavedradiamond wedding anniversaryfrancis scott key fitzgeralddistinguished service medalcentral intelligence agencyedmund john millington syngesecret intelligence serviceantonio allegri da correggioreligious society of friendsbeggar-my-neighbour strategy
...View all with 25 letters...
Phrases (67)
charlotte anna perkins gilmanfrances eliza hodgson burnettright atrioventricular valvebrassica oleracea gongylodespolicing and enforcement costhunting and gathering societyanton grigorevich rubinsteinmalignant neoplastic diseasepersonal information managerkarl rudolf gerd von rundstedt
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (50)
nikita sergeyevich khrushchevgeorge percy aldridge graingeraleksandr sergeyevich pushkinoffice of management and budgetaugustus welby northmore puginco-operative republic of guyanabeta-adrenergic blocking agentnuclear regulatory commissiontricyclic antidepressant drugjames augustine aloysius joyce
...View all with 27 letters...
Phrases (52)
revolutionary people's strugglebusiness process reengineeringbureau of engraving and printingephippiorhynchus senegalensismarcus junius brutus the youngermicrosoft disk operating systembattles of lexington and concordcapital of serbia and montenegrodemocratic republic of the congofederal housing administration
...View all with 28 letters...
Phrases (30)
male internal reproductive organdisorganized type schizophreniaautomatic data processing systemsouth-central dravidian languagegiovanni pierluigi da palestrinaedward george earle bulwer-lyttonreceived pronunciation languagehydrangea macrophylla hortensisstephanus johannes paulus krugerautoclaved lightweight concrete
...View all with 29 letters...
Phrases (16)
reduced instruction set computingglutamic oxalacetic transaminasedepartment of energy intelligencerepublic of bosnia and herzegovinaaugust friedrich leopold weismanncomplex instruction set computingnontricyclic antidepressant drughenri rene albert guy de maupassantsisters of st. michael the archangel1st viscount montgomery of alamein
...View all with 30 letters...
Phrases (30)
bureau of intelligence and researchmarie louise elisabeth vigee-lebrunguiseppe fortunino francesco verdisidonie-gabrielle claudine colettepalestine liberation organizationpalestinian popular struggle frontelectromotive drug administrationport-access coronary bypass surgeryislamic great eastern raiders-frontgeorges eugene benjamin clemenceau
...View all with 31 letters...
Phrases (19)
african american vernacular englishpeople against gangsterism and drugsdepartment of the federal governmentweakly interacting massive particlesergei aleksandrovich koussevitzkystraight-line method of depreciationrevolutionary justice organizationobject-oriented programing languageisidore auguste marie francois comtecockcroft-walton voltage multiplier
...View all with 32 letters...
Phrases (20)
linear-quadratic-gaussian controllermusical instrument digital interfaceinternational maritime organizationstandard generalized markup languageobject-oriented programming languageorganization of the oppressed on earthpityrogramma calomelanos aureoflavaelizabeth cleghorn stevenson gaskellprivilege against self incriminationgeneral agreement on tariffs and trade
...View all with 33 letters...
Phrases (24)
relational database management systemfederal national mortgage associationgeorge louis palmella busson du mauriernero claudius caesar drusus germanicusinterstitial cell-stimulating hormonefriedrich august kekule von stradonitzkolmogorov's strong law of large numberseuropean law enforcement organisationvena centralis glandulae suprarenalisfunctional magnetic resonance imaging
...View all with 34 letters...
Phrases (12)
revolutionary organization 17 novembercanadian security intelligence serviceimmaculate conception of the virgin marycockcroft and walton voltage multipliernational socialist german workers' partyimmigration and naturalization serviceanti-imperialist international brigadefederal law enforcement training centerballistic missile defense organizationsubacute sclerosing leukoencephalitis
...View all with 35 letters...
Phrases (10)
jakob ludwig felix mendelssohn-bartholdyangiotensin-converting enzyme inhibitorforeign intelligence surveillance courtnational geospatial-intelligence agencyalbert francis charles augustus emmanuelcriminal intelligence services of canadanatural language processing applicationtiberius claudius drusus nero germanicusdeclining balance method of depreciationunited states government printing officePhrases (7)
sisters of the order of saint basil the greatdemocratic and popular republic of algeriagenerally accepted accounting principlessecretary of housing and urban developmentdefense advanced research projects agencyepistle of paul the apostle to the galatianscongregation of the sisters of saint hedwigPhrases (7)
million floating point operations per secondbillion floating point operations per seconddefense reutilization and marketing servicedirectorate for inter-services intelligencegates of the arctic national park and preservebaron hermann ludwig ferdinand von helmholtzenzyme-linked-immunosorbent serologic assay