Words Containing: E,D,A,L,L,Y
(In Any Order)
There are 549 words,
1,012 phrases and
0 abbr's with
E,D,A,L,L,Y in.
Best Scoring Words With: E,D,A,L,L,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
ideally | 7 | 11 | adverbadv | |||||
adverb • in an ideal manner | ||||||||
allayed | 7 | 11 | verbv | |||||
verb • lessen the intensity of or calm • satisfy (thirst) | ||||||||
alloyed | 7 | 11 | verb, adjectivev, adj | |||||
adjective satellite • (used of metals) debased by mixture with an inferior element • (used of metals) blended to obtain a desired property | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (49)
allegedlymedicallyfederallybellybandsalesladydamselflyunalloyedmedullarybelatedlyunallayedexaltedlydextrallyrelaxedlyeyeballeddelayableyieldabledecimallyadrenallytallyhoededictallyoedipallydayliliesrelatedlywelladaysbipedallylaboredlyladylovesallowedlylearnedlyalkylatedsyllabledleewardlyalarmedlydrywalledplayfield
...View all with 9 letters...
Phrases (7)
legal dutyold baileylead bellyadobe lilymedal playlady's leekdelay lineWords (45)
dreadfullydelicatelydesolatelyclydesdaleunladyliketalleyranddeplorablydisyllableresiduallyballyhooedremediallybellyachedgladsomelydelectablyplayfieldsmedievallypolyhedralpleadinglydialyzabledetailedlylamentedlydreamfullysyllabizedbellybandsdeployablesidereallyjollyheadschandlerlydialysabledeclaredlyall-firedlyundulatelyyellowheadladybeetlefadelessly
...View all with 10 letters...
Phrases (12)
woody allenblind alleylady killeredna millaylady beetlelady chapelbelly dancelady's lacesmeadow lilysell-by date
...View all with 10 letters...
Words (60)
melodicallyidenticallywensleydaleanecdotallycomedicallymedicinallylegendarilyeditoriallydissyllablephyllocladedauntlesslyregardfullyveridicallydeathlesslylallygaggedhedonicallydisplayableeideticallylollygaggeddialectallyendosteallyedaphicallyplasmolyzeddisyllablesqualifiedlybullyraggedendemicallyballyraggeddelphicallydeisticallysubdermallydecenniallysyllabifieddemonicallyadverbially
...View all with 11 letters...
Phrases (15)
boulder clayalkyl halidewild parsleybastille dayleading ladyleyte islandbelly dancerdaily doubleyellow cedaryellow dwarf
...View all with 11 letters...
Words (96)
accidentallydeliberatelyincidentallyperiodicallycrystallizedacademicallydomesticallymethodicallyevidentiallyfraudulentlyindelicatelycalculatedlylandlubberlycrystallisedpedanticallyhebdomadallymisleadinglyregardlesslymultilayeredprudentiallydecasyllableideationallyhydrolyzabledesolatinglydillydallieddisloyaltiesadulterouslyepisodicallydespoticallyadjectivallydevotionallybullheadedlyprocedurallysyndeticallyslanderously
...View all with 12 letters...
Phrases (26)
read-only filejail deliveryedmond halleyedmund halleydisplay panelresidual clayaldous huxleylinden familyethyl radicalplaying field
...View all with 12 letters...
Words (83)
fundamentallyideologicallydimensionallyeducationallydiametricallydisgracefullyquadrenniallyunqualifiedlydeferentiallyclandestinelyhalfheartedlypedagogicallydelectabilitydetrimentallyknowledgeablyprejudiciallydyspepticallycomplicatedlyaperiodicallyclearheadedlycoldheartedlytetrahedrallydistastefullyhyperboloidalanecdoticallydeclarativelydactylologiesinterdentallydecasyllabicsdecasyllablesintradermallypolydactyliesstraitlacedlysolderabilityperiodontally
...View all with 13 letters...
Phrases (38)
family laridaeadmiralty milejekyll and hydeedmund hillaryamyloid plaquebenzyl radicalcelestial bodypays de la loireadult male bodyvachel lindsay
...View all with 13 letters...
Words (75)
coincidentallywholeheartedlydemocraticallyconfidentiallydifferentiallyidealisticallyprovidentiallyorthopedicallydepartmentallydisconsolatelydeliberativelylightheartedlymalcontentedlyhedonisticallydemoralizinglyimmethodicallyrecrystallizedadrenergicallypolyacrylamidepresidentiallydolichocephalyacknowledgedlyclairaudientlydeliverabilityglutaraldehydeinsecticidallyhypodermicallyuncrystallizedinterrelatedlydorsoventrallyglyceraldehydebactericidallyendodonticallyhydrothermallymuddleheadedly
...View all with 14 letters...
Phrases (64)
william tyndaleadmiralty metalfamily rallidaephylum annelidalateral condyleraymond cattellfamily soleidaefamily talpidaefield artillerydame ellen terry
...View all with 14 letters...
Words (66)
developmentallyaerodynamicallydemographicallyperpendicularlybidirectionallyunadulteratedlypsychedelicallyradiometricallysemicylindricaltetramethylleadcoeducationallypolyacrylamidesreduplicativelysynecdochicallyhydrometallurgyglutaraldehydesglyceraldehydesgrandiloquentlyhemodynamicallyideographicallyallotetraploidyradiochemicallyelectrodialyseselectrodialysiselectrodialyticeudiometricallyhendecasyllabichendecasyllableextrajudiciallyyieldablenesseshydrogeologicalamaryllidaceousendothermicallyknowledgabilityacidimetrically
...View all with 15 letters...
Phrases (91)
class pelecypodafamily leporidaefamily triglidaefamily lophiidaefamily balanidaefamily blattidaefamily mugilidaefamily mytilidaeadult female bodyfamily siluridae
...View all with 15 letters...
Words (21)
lyginopteridalesdenominationallyautopolyploidiesdodecaphonicallyleptotyphlopidaeelectrohydraulicallopolyploidiesphyllostomatidaehendecasyllabicshendecasyllablesundemocraticallyencyclopedicallypalaeodendrologytranscendentallymelodramaticallycladogeneticallymethodologicallypaedogeneticallytetramethylleadsunidirectionallyknowledgeabilityPhrases (100)
family locustidaefamily balaenidaefamily elateridaefamily blenniidaeorder polygonalesgrand mal epilepsyflat panel displayfamily fulgoridaereligious holidayglyceric aldehyde
...View all with 16 letters...
Words (13)
thermodynamicallycercidiphyllaceaekaleidoscopicallyjurisprudentiallyturbidimetricallyphotoperiodicallydeterministicallyepidemiologicallyhydroelectricallyhydrometallurgiesdialectologicallyhydrometallurgisteleutherodactylusPhrases (108)
family trochilidaefamily didelphidaefamily engraulidaeafrican yellowwoodgenus phyllocladusbladderwort familyorder thymelaealesacoustic delay lineauxiliary airfieldnail-tailed wallaby
...View all with 17 letters...
Words (6)
cylindrical-stemmedlipopolysaccharidediethylmalonylureahydrometallurgicalsedimentologicallyhydrometallurgistsPhrases (92)
bombycilla cedrorunmodal auxiliary verbfamily meliphagidaefamily motacillidaeamlodipine besylatenew world flycatcheredward bulwer-lyttonalfred lord tennysonfamily scolopacidaedigitalis glycoside
...View all with 18 letters...
Words (6)
lipopolysaccharidesphosphatidylcholineinterdepartmentallyencephalomyelitideshydrometeorologicalmultidimensionalityPhrases (97)
acetylsalicylic acidfamily cyclopteridaefamily cynoglossidaefamily lepisosteidaefamily polypodiaceaeviral delivery vectoredna st. vincent millayfamily calliphoridaecholoepus didactylusglycerinated gelatin
...View all with 19 letters...
Words (3)
phosphoglyceraldehydedendrochronologicallypolyvinyl-formaldehydePhrases (45)
aleksandr solzhenitsynptolemy ii philadelphussamuel taylor coleridgephysalis philadelphicaorder lyginopteridalesyellow-eyed grass familyfamily phyllocladaceaeandromeda glaucophyllaclustered lady's slipperonion yellow-dwarf virus
...View all with 21 letters...
Words (2)
phosphoglyceraldehydesdihydroxyphenylalaninePhrases (51)
aleksandr i. solzhenitsynfamily dendrocolaptidaeedna saint vincent millaysomaliland monetary unitedward kennedy ellingtonfamily phyllostomatidaemary ludwig hays mccauleyperfectly elastic demandfamily lepidobotryaceaegenus eleutherodactylus
...View all with 22 letters...
Words (2)
electrocardiographicallyphosphatidylethanolaminePhrases (28)
subphylum cephalochordatamary wollstonecraft godwinprivately held corporationalexandre emile jean yersinalfred edward woodley masonfederal republic of germanyhenry wadsworth longfellowsir charles leonard woolleyhelen laura sumner woodburypaul johann ludwig von heyse
...View all with 24 letters...
Words (1)
phosphatidylethanolaminesPhrases (18)
caulophyllum thalictroideslepidocybium flavobrunneumreticuloendothelial systemdevelopmentally challengeddiesel-hydraulic locomotivesubfamily caesalpinioideaecladorhyncus leucocephalumnational library of medicinepelvic inflammatory diseasebradley method of childbirth
...View all with 25 letters...
Phrases (17)
brassica oleracea gongylodescharles maurice de talleyrandrevolutionary calendar monthgilles de la tourette syndromeconjunctival layer of eyelidsuniformly decelerated motionhereditary cerebellar ataxiadiethylaminoethyl celluloseleptodactylus pentadactylusamitriptyline hydrochloride
...View all with 26 letters...
Phrases (12)
american revolutionary leaderorder of our lady of mount carmelbaron lloyd webber of sydmontontopical prostaglandin eyedropfalkland islands monetary unitatrioventricular nodal rhythmisobutylphenyl propionic acidlimb-girdle muscular dystrophyu.s. national library of medicinefederal republic of yugoslavia
...View all with 27 letters...
Phrases (10)
aleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderedward george earle bulwer-lyttonhydrangea macrophylla hortensislydia kamekeha paki liliuokalanipresident william henry harrisoncypripedium calceolus pubescensdecimal system of classificationmaturity-onset diabetes mellitusPhrases (1)
enzyme-linked-immunosorbent serologic assay