Words Containing: D,K,S,Y
(In Any Order)
There are 208 words,
244 phrases and
0 abbr's with
D,K,S,Y in.
Best Scoring Words With: D,K,S,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
dybbuks | 7 | 19 | nounn | |||||
noun • (Jewish folklore) a demon that enters the body of a living person and controls that body's behavior | ||||||||
skyward | 7 | 18 | adverbadv | |||||
adverb • toward the sky adjective satellite • directed toward heaven or the sky | ||||||||
skydive | 7 | 18 | verbv | |||||
verb • jump from an airplane and perform various maneuvers before opening one's parachute | ||||||||
droshky | 7 | 18 | nounn | |||||
noun • an open horse-drawn carriage with four wheels; formerly used in Poland and Russia | ||||||||
skidway | 7 | 18 | nounn | |||||
Valid word for Scrabble US
| ||||||||
skydove | 7 | 18 | nounn | |||||
Valid word for Scrabble US
| ||||||||
keypads | 7 | 17 | nounn | |||||
noun • a keyboard that is a data input device for computers; arrangement of keys is modelled after the typewriter keyboard | ||||||||
dickeys | 7 | 17 | nounn | |||||
noun • a small third seat in the back of an old-fashioned two-seater • a man's detachable insert (usually starched) to simulate the front of a shirt adjective satellite • (British informal) faulty | ||||||||
disyoke | 7 | 15 | verbv | |||||
Valid word for Scrabble US
| ||||||||
kidneys | 7 | 15 | nounn | |||||
noun • either of two bean-shaped excretory organs that filter wastes (especially urea) from the blood and excrete them and water in urine | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (35)
weekdaysskydiverskywardsdisyokeddaybooksskydivedkeycardskatydidsskidwayskyaniseddisyokeskeywordskyboshedmisyokedvandykesskyboardworkdaysskydivesdayworkscopydeskhydroskiladykinsdovekeysheyducksskew-eyeddye-worksdaymarksunderskydaysacksilkadaysyakhdansyoicksedmiskeyeddaktyloskakodylsPhrases (1)
city deskWords (38)
skydivingyardstickstockyardkandinskyskydiversskyjackedskysurfedankylosedyardworksdockyardskaleyardskeyboardsdisyokingphysickeddaybreaksskyboardsskybridgeshylockedskylarkedbackyardscopydeskshydroskiskailyardsjunkyardsbodyworksbulldykespyinkadoskeystonedklondykesduskishlyworkadayskirkyardsyeldrocksdaisylikeskinny-dip
...View all with 9 letters...
Phrases (7)
dry socketsay hey kidthomas kydlady's leekwork studycandy kisssticky endWords (39)
dostoevskydyskinesiakeystrokeddyskineticskylightedbrickyardsyardsticksdoohickeyspaddywacksflyspeckedskybridgesskydivingsmonkeypodsswaybackeddayworkersbackwoodsystockyardsbodycheckskindlesslythylakoidsdisk-jockeylackadaisyklondykerskyphosidaekirkyairdssunken-eyedkailyairdssyndetikonhandyworksdickybirdsdickey-seatstackyardsdisc-jockeyrock-steadydandyfunks
...View all with 10 letters...
Phrases (6)
floppy diskalkyd resinlady's smockdusky sharksleepy dickquick studyWords (25)
dostoyevskyskulduggerykeyboardisttiddlywinksskyrocketeddonnybrooksbradykininsdyskinesiasrekeyboardsdonkeyworkshydrocrackskeyboardersspiny-backedskuldudderycockneydomswhiskeyfiedpaddywhacksturkey-sizedflunkeydomsdickeybirdsbodyworkersrosy-cheekedsilky-hairedsilky-leafedsilky-leavedPhrases (9)
dirty tricksmuscovy ducktahoka daisydyer's rocketstinky squiddick fosburyjack dempseysydney silkykidney stoneWords (14)
skullduggerykeyboardistscockeyednesskeyboardingsbradykinesiastickybeakedhoneysuckledtiddleywinksladylikenessdusky-coloredskinny-dippermusky-scentedkidney-shapedyurak-samoyedPhrases (11)
body stockingdomesday bookalfred kinseydoomsday bookdenmark veseyslippery dickall-day suckerspider monkeyrayleigh diskguy fawkes day
...View all with 12 letters...
Words (9)
holidaymakersgobbledygookstiddledywinkshydrocrackersbradykinesiashydrokineticsdostoyevskiandusky-colouredostyak-samoyedPhrases (18)
el iskandriyahthree kings' daydiospyros kakiryukyu islandstank destroyergenus kennedyasnake polypodyblended whiskylaundry basketst patrick's day
...View all with 13 letters...
Phrases (1)
modest petrovich moussorgskyPhrases (1)
technical analysis of stock trendsPhrases (1)
vladimir vladimirovich mayakovskiPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assayPhrases (1)
international relations and security network