Words Containing: D,K,N,Y
(In Any Order)
There are 155 words,
305 phrases and
0 abbr's with
D,K,N,Y in.
Best Scoring Words With: D,K,N,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| vandyke | 7 | 18 | verb, noun, adjectivev, n, adj | |||||
noun • a short pointed beard (named after the artist Anthony Vandyke) • Flemish painter of numerous portraits (1599-1641) | ||||||||
| nakedly | 7 | 15 | adverbadv | |||||
adverb • in an exposed manner; without protection or defense • without clothing | ||||||||
| unyoked | 7 | 15 | verbv | |||||
verb • remove the yoke from | ||||||||
| kidneys | 7 | 15 | nounn | |||||
noun • either of two bean-shaped excretory organs that filter wastes (especially urea) from the blood and excrete them and water in urine | ||||||||
| enskyed | 7 | 15 | verb, adjectivev, adj | |||||
Valid word for Scrabble US
| ||||||||
| dinkeys | 7 | 15 | nounn | |||||
noun • a small locomotive | ||||||||
| ladykin | 7 | 15 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| dyking | 6 | 15 | verb, adjectivev, adj | |||||
noun • The process of building a dike. | ||||||||
| donkeys | 7 | 15 | nounn | |||||
noun • the symbol of the Democratic Party; introduced in cartoons by Thomas Nast in 1874 • domestic beast of burden descended from the African wild ass; patient but stubborn | ||||||||
| donkey | 6 | 14 | nounn | |||||
noun • the symbol of the Democratic Party; introduced in cartoons by Thomas Nast in 1874 • domestic beast of burden descended from the African wild ass; patient but stubborn | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
kyndWords (22)
skydivingdrunkenlyhackneyedkandinskyankylosedkiddinglydisyokingdrinkablyjunkyardsmonkeypodpyinkadoskeystonedklondykedklondykerklondykesvandykinghunky-dorycandy-likehandyworkskinny-dipdandyfunkkiddywinkPhrases (9)
duke waynerock candycandy kissmonkey dogsticky endmonkey podkiddy pornkidney pienaked ladyWords (25)
unladylikedonnybrookdyskinesiadonkeyworkdyskinetickeypunchedbradykininskydivingsmonkeypodskindlesslykidneylikecockneydomklondykersklondykingkantikoyedflunkeydomsunken-eyedtiddlywinksyndetikoncandymakercankeredlyhandyworksdandyfunkskiddywinksklendusityPhrases (14)
hook and eyeworking daykidney fernkidney wortketone bodyyard donkeyalkyd resinlucky lindykhayr ad-dinpancake day
...View all with 10 letters...
Words (17)
kinyarwandatiddlywinkshyperlinkedbookbinderydonnybrookskeyboardingbradykininscockneyfieddyskinesiasunhackneyeddonkeyworksspiny-backedcockneydomsmonkeyglandflunkeydomstiddleywinkquick-dryingPhrases (11)
bryan donkinchicken yardstinky squidbank holidaycape kennedyjack kennedysydney silkymonkey breadkidney stoney-linked gene
...View all with 11 letters...
Words (18)
cockeyednesspaddywackinghydrokineticdrinkabilitybodycheckingbackhandedlykeyboardingsbradykinesiaknowledgablyhoneysuckledyankee-doodleunprovokedlytiddledywinktiddleywinksladylikenessskinny-dippermusky-scentedkidney-shapedPhrases (22)
body stockingalfred kinseyback of beyondtake kindly todonkey enginedonkey jacketdarryl zanuckcylinder lockdenmark veseygrey kingbird
...View all with 12 letters...
Words (10)
knowledgeablyrekeyboardinghydrocrackingtiddledywinkskindheartedlybradykinesiaskitty-corneredhydrokineticsdostoyevskianhydraulickingPhrases (29)
el iskandriyahjekyll and hydenook and crannythree kings' dayryukyu islandstank destroyerdarryl f. zanuckcylinder blockgenus kennedyasnake polypody
...View all with 13 letters...
Words (8)
cockeyednessesacknowledgedlyhydrocrackingshydrokineticalvelvety-skinnedladylikenessesdiphenylketonebrachypinakoidPhrases (24)
anthony van dyckanthony vandykedimethyl ketonedrunken revelryveliky novgorodblended whiskeyold world monkeyemily dickinsondynamic speakerkeynote address
...View all with 14 letters...
Words (7)
brokenheartedlypyknodysostosespyknodysostosisknowledgabilityacknowledgeablydiphenylketonesbrachypinakoidsPhrases (24)
docking facilityandrei tarkovskymonkey-bread treemaryland chickenstinking gladwynstinking mayweedredundancy checkbracketed blennythanksgiving dayfloating dry dock
...View all with 15 letters...
Phrases (11)
family threskiornithidaecanyonlands national parkauto-blocking belay devicefriedrich august von hayekgrand canyon national parktrofim denisovich lysenkosir frederick handley pagenaked as the day one was bornpolycystic kidney diseasemultibank holding company
...View all with 23 letters...
Phrases (1)
dorothy mary crowfoot hodgkinPhrases (1)
technical analysis of stock trendsPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assayPhrases (1)
international relations and security network
