Words Containing: D,I,M,L,Y
(In Any Order)
There are 705 words,
1,760 phrases and
0 abbr's with
D,I,M,L,Y in.
Best Scoring Words With: D,I,M,L,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
mixedly | 7 | 20 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
mildewy | 7 | 16 | adjectiveadj | |||||
adjective • Of, pertaining to, or affected with mildew | ||||||||
humidly | 7 | 16 | nounn | |||||
Valid word for Scrabble US
| ||||||||
dumpily | 7 | 15 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
dimply | 6 | 14 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
muddily | 7 | 14 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
myeloid | 7 | 13 | adjectiveadj | |||||
adjective • of or relating to bone marrow • marrowlike • of or relating to bone marrow cells | ||||||||
timidly | 7 | 13 | adverbadv | |||||
adverb • in a shy or timid or bashful manner | ||||||||
moodily | 7 | 13 | adverb, adjectiveadv, adj | |||||
adverb • in a moody manner | ||||||||
amyloid | 7 | 13 | noun, adjectiven, adj | |||||
noun • a non-nitrogenous food substance consisting chiefly of starch; any substance resembling starch • (pathology) a waxy translucent complex protein resembling starch that results from degeneration of tissue adjective satellite • resembling starch | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
dimlyWords (49)
diplomacymedicallyadmiraltychlamydiapyramidaladmirablylimitedlymindfullylimpidityunmixedlydemulsifymediatelyolympiadsdecimallylampyridsamplidynemaudlinlymisplayeddisemploydynamicalamygdalinsympodialdamninglymisstylednymphaliddomicallypolyamidedimethylspolyimidemidweeklyamaryllidimpliedlyimpavidlysymphiliddysmelias
...View all with 9 letters...
Phrases (3)
milk yieldwild thymelady's maidWords (67)
admittedlysymbolizedmyocardiallycopodiumsymbolisedmindlesslyimpudentlyunmaidenlyformidablymodularitymixolydianimmodestlyadmiringlyamygdaloidmyelinatedacrylamidedamaginglyanimatedlydominantlymyelitidesremediallymiddlinglyinformedlypolyamidesmedievallybimodalitymidnightlyamplidynesmanifoldlydisemploysamygdalinsnymphalidschlamydialpolyimideschlamydiae
...View all with 10 letters...
Phrases (6)
olympic godmyrtle birdbird familyedna millaymeadow lilymelody pipeWords (82)
immediatelydeliverymanamyloidosismelodicallydynamicallydisarminglycomedicallyhomicidallymedicinallyimprudentlydisassemblymandatorilypyramidicalmelodiouslymisguidedlydeliverymenconfirmedlydismayinglyunlimitedlyindomitablymaladroitlymaddeninglyacrylamidesamphiploidyabdominallymolybdenitelycopodiumsdemandinglypyramidallyendemicallydisemployedmaledictorymisemployeddilatometryamygdaloids
...View all with 11 letters...
Phrases (23)
admiral byrdmemorial daymiddle fiftymelvil deweygladys smithlyme diseasegod almightydirty old mangourd familywilliam byrd
...View all with 11 letters...
Words (99)
dramaticallyacademicallydomesticallymethodicallyepidemiologymythologizedcardiomegalylymphomatoidimmoderatelydeterminablydogmaticallydeterminedlyirredeemablyadmirabilitymendaciouslyamygdaloidalsyndactylismholidaymakermisleadinglyirremediablyprimordiallydepolymerizemultilayeredcommodiouslyetymologisedetymologizedmodulabilitycommandinglymeditativelydissimilarlyunmyelinateddemulsifyinghemodialysissyndicalismsimponderably
...View all with 12 letters...
Phrases (27)
admiral deweyadmiralty lawmaterial bodydwight l. moodydevil-may-caredramatic playfamily boidaefolding moneyfamily zeidaesundew family
...View all with 12 letters...
Words (109)
predominantlydissimilaritydimensionallypredominatelydiametricallypolydactylismendolymphaticspasmodicallyadmissibilityadmonishinglydemythologizedetrimentallyholidaymakersamphidiploidydepolymerizedcompendiouslylymphadenitisaerodynamicalnonmyelinatedadumbrativelymollycoddlingrudimentarilymodifiabilitydeterminatelyunmitigatedlycomplicatedlymonoglyceridejudgmaticallycopolymerizeddissimilatorydepolymerizessyndactylismssedimentologydemyelinatingsemilegendary
...View all with 13 letters...
Phrases (73)
family laridaefamily picidaeadmiralty milefamily bovidaeedmund hillaryamyloid plaquemilitary drillfamily muridaemyles standishprinted symbol
...View all with 13 letters...
Words (91)
democraticallyclitoridectomydimensionalitydiplomaticallyintermediatelydemythologiseddemythologizedabsentmindedlydepolymerizingdenumerabilityambidextrouslyintimidatinglyelectrodynamicdiphenylaminesremythologizedincommodiouslyhydrodynamicaldemoralizinglyimmethodicallyantidromicallyfeeblemindedlyindemonstrablypolyacrylamideextrapyramidalencyclopedismsdemyelinationssimplemindedlydemythologizerdemythologizesundogmaticallyindomitabilityhypodermicallyindeterminablydermatoglyphichyperlipidemia
...View all with 14 letters...
Phrases (133)
moonseed familywilliam tyndaledimethyl ketonefamily ardeidaeadmiralty brassadmiralty metalmodal auxiliarybusman's holidaypolymeric amidefamily turdidae
...View all with 14 letters...
Words (68)
aerodynamicallycardiopulmonarymethylphenidatedramaturgicallydemonstrativelydemographicallyaccommodatinglydemonstrabilityhydromechanicalimponderabilitypoliomyelitideshyperstimulatedinadmissibilityradiometricallysemicylindricalpolyacrylamidesindeterminatelyhyperlipidemiasdemythologizersdemythologizinglymphadenitisesdithyrambicallydermatoglyphicshemodynamicallythermodynamicalradiochemicallyelectrodynamicseudiometricallylaryngectomizeddecomposabilitymultitudinouslyhobbledehoyismsamaryllidaceousdemeritoriouslyencyclopaedisms
...View all with 15 letters...
Phrases (203)
helen wills moodydialysis machinefamily tinamidaemail-order buyingfamily leporidaefamily artamidaeadmiralty islandfamily astacidaefamily triglidaefamily lophiidae
...View all with 15 letters...
Words (24)
indiscriminatelydiscriminatorilyparadigmaticallyadministrativelydimethylglyoximedenominationallycyclophosphamideimmunomodulatoryundiplomaticallyhyperlipoidaemiamethylphenidatesphyllostomatidaephotodynamicallyundemocraticallydepolymerizationancylostomatidaehydrodynamicallydiacetylmorphinecalcium-cyanamidemelodramaticallymethodologicallydiagrammaticallydiscriminabilitydiscriminatinglyPhrases (188)
hypodermic needlefamily cyprinidaepodocarpus familyfamily locustidaedwight lyman moodyfamily balaenidaefamily elateridaefamily blenniidaefamily pythonidaefamily buccinidae
...View all with 16 letters...
Words (22)
thermodynamicallymultidisciplinarylymphadenopathiescyclophosphamidesthiodiphenylaminetridimensionalityturbidimetricallydepolymerizationstwo-dimensionalityone-dimensionalitydeterministicallyuncomprehendinglyepidemiologicallyhydrometallurgieshydrometallurgistdiaphragmaticallypsychodynamicallyundemonstrativelydemythologisationdemythologizationdimethylhydrazineunidimensionalityPhrases (191)
lycopodium alpinumfamily dasypodidaefamily trochilidaefamily didelphidaecapital of marylandfamily droseraceaehexadecimal systemmiles dewey davis jr.family engraulidaesubfamily turdinae
...View all with 17 letters...
Words (17)
hyperaldosteronismcylindrical-stemmeddiethylmalonylureamucopolysaccharidehydroflumethiazidedemythologizationsmethylprednisolonecholecystectomizedhydrometallurgicalsedimentologicallyhydrometallurgistshydrometeorologieshydrometeorologistindiscriminatinglydiethylcarbamazinedimethylhydrazinesdimethyltryptaminePhrases (159)
bombycilla cedrorunfamily physeteridaedame sybil thorndikepodilymbus podicepsread-only memory chipfamily trichechidaefamily desmidiaceaemodal auxiliary verbmarquis de lafayettedylan marlais thomas
...View all with 18 letters...
Words (15)
mucopolysaccharidespharmacodynamicallyphenylthiocarbamideinterdepartmentallythird-dimensionalitythree-dimensionalitymethylprednisolonesencephalomyelitideshydrometeorologicalhydrometeorologistsdiethylcarbamazinestetramethyldiarsinedimethylnitrosaminedimethyltryptaminesmultidimensionalityPhrases (176)
family cyclopteridaefamily cynoglossidaefamily lepisosteidaefamily dasyproctidaefamily polypodiaceaesubfamily perdicidaeedna st. vincent millayfamily calliphoridaegerard manley hopkinsfundamental quantity
...View all with 19 letters...
Words (5)
radioimmunoassayablemagnetofluiddynamicsphenylthiocarbamidesencephalomyocarditisdimethylnitrosaminesPhrases (155)
order mycelia steriliaorder myxobacterialesfamily trachipteridaeclyde william tombaughfamily dermochelyidaefamily pseudococcidaeambystomid salamanderorder actinomycetaleshamamelid dicot familyamyloid protein plaque
...View all with 20 letters...
Words (2)
mucopolysaccharidosispolyvinyl-formaldehydePhrases (89)
icelandic monetary unitfamily rhinotermitidaeptolemy ii philadelphussamuel taylor coleridgefamily myrmecophagidaeprosopium cylindraceumacanthocybium solandrivladimir ilyich ulyanovsuperfamily tyrannidaeyellow-eyed grass family
...View all with 21 letters...
Words (1)
encephalomyocarditisesPhrases (84)
redevelopment authorityhydrated aluminium oxidefamily dendrocolaptidaesubfamily bassariscidaesodium tripolyphosphaterhythm and blues musicianathyrium thelypteroidesmale reproductive systembrachycome iberidifoliafamily branchiostomidae
...View all with 22 letters...
Words (1)
phosphatidylethanolaminePhrases (41)
mary wollstonecraft godwinzollinger-ellison syndromealexandre emile jean yersinapocynum androsaemifoliumtechnology administrationfederal republic of germanyel salvadoran monetary unitperfectly inelastic demandfamily plasmodiophoraceaeelectromagnetic delay line
...View all with 24 letters...
Words (1)
phosphatidylethanolaminesPhrases (32)
edmund john millington syngepolystichum acrostichoidescaulophyllum thalictroideslepidocybium flavobrunneumtympanuchus pallidicinctusreticuloendothelial systemmelville louis kossuth deweyleboyer method of childbirthnational academy of sciencesmachine readable dictionary
...View all with 25 letters...
Phrases (25)
submandibular salivary glandcharles maurice de talleyrandrevolutionary calendar monthbureau of diplomatic securityentandrophragma cylindricumgilles de la tourette syndromeuniformly decelerated motionrhythm method of birth controlcalycophyllum candidissimumscardinius erythrophthalmus
...View all with 26 letters...
Words (1)
ethylenediaminetetraacetatePhrases (20)
american revolutionary leaderholy roman emperor frederick iicommissioned military officerfalkland islands monetary unitatrioventricular nodal rhythmhydraulic transmission systemsysteme international d'unitesdemeclocycline hydrochloridedactylorhiza maculata fuchsiipleomorphic rhabdomyosarcoma
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (16)
fyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationfeodor mikhailovich dostoevskydepartment of homeland securitydissident irish republican armysodium carboxymethyl cellulosesingle nucleotide polymorphismnonsteroidal anti-inflammatoryfield-sequential color tv system
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (12)
middle east respiratory syndromehydrangea macrophylla hortensislydia kamekeha paki liliuokalanipresident william henry harrisontheory of punctuated equilibriumfyodor mikhailovich dostoyevskypressure-feed lubricating systemcypripedium calceolus pubescensdecimal system of classificationfeodor mikhailovich dostoyevsky
...View all with 29 letters...
Phrases (1)
enzyme-linked-immunosorbent serologic assay