Words Containing: D,G,Y
(In Any Order)
There are 1,681 words,
1,431 phrases and
0 abbr's with
D,G,Y in.
Best Scoring Words With: D,G,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| zygoid | 6 | 20 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
| pygmoid | 7 | 16 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
| kludgey | 7 | 16 | adjectiveadj | |||||
adjective • Sloppy, hasty, shoddy, or inelegant | ||||||||
| dignify | 7 | 15 | verbv | |||||
verb • confer dignity or honor upon • raise the status of | ||||||||
| fidgety | 7 | 15 | adjectiveadj | |||||
adjective satellite • nervous and unable to relax | ||||||||
| doughty | 7 | 15 | adjectiveadj | |||||
noun • A person who is bold or brave. adjective • Bold; brave, courageous. | ||||||||
| kludgy | 6 | 15 | adjectiveadj | |||||
adjective • Sloppy, hasty, shoddy, or inelegant | ||||||||
| gypped | 6 | 15 | verbv | |||||
noun • (sometimes offensive) an act of swindling or cheating verb • (sometimes offensive) to cheat or swindle | ||||||||
| dayglow | 7 | 15 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
| voyaged | 7 | 15 | verb, adjectivev, adj | |||||
noun • an act of traveling by water • a journey to some distant place verb • travel on water propelled by wind or by other means | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (85)
goodbyetragedydignitydenyingprodigytidyingraggedyundyingungodlyladybuggrandlydignifyorgandygiddilyrigidlyfidgetydaylonggoldwynyardagesquidgydoughtybogeyedgauderygaudilypygmoidpudgilygypsiedgelidlycoydogsgyratedbodyingdrayinggoldeyedingeyseddying
...View all with 7 letters...
Phrases (9)
doggy dogood guyflag daydog daysgood daybag ladyglide byday gamebody bagWords (171)
studyingdaylightburgundyhydrogenideologyyodelingyieldingdallyingrigidityamygdaladirtyingpedagogydizzyingdoughboydraughtydrudgeryedifyinggoodyearganymedereadyinggreedilydemagogyridgewaybandyingcaddyingdoggedlytoadyingruggedlydummyingdoxologyedgewaysdogsbodyraggedlydivvyinggadgetry
...View all with 8 letters...
Phrases (16)
egg yieldbandy legdrying upditty bagjay gouldold gloryby designdoggy baggrey bodydirty dog
...View all with 8 letters...
Words (209)
bodyguardgraduallylegendarygraveyardyggdrasilallegedlydragonflydaylightsgreyhoundradiologydigitallyskydivingindignitydignitaryglycosidefrigiditymodifyinghydrangeabudgetarydysgenicsaudiologysteadyingyodellinghydrologyhydratingandrogynyembodyingdashinglydismayingdoggishlybrandyingremedyingmuybridgeadoringlylanguidly
...View all with 9 letters...
Phrases (29)
guard dutyground ivyyard grasslegal dutygood storyyoung birdyoung ladyboxing daygrey alderyard goods
...View all with 9 letters...
Words (232)
playgroundunderlyinggranddaddydiligentlyunyieldingderogatorycardiologydiagonallydynamitingblindinglydemonologydramaturgyoxygenatedgrudginglygrindinglydegeneracyladyfingertroglodyteoxygenizeddaughterlydauntinglydazzlinglyodontologydignifyingadmiringlyindulgencyglyptodontdesignedlyamygdaloiddetergencyunedifyingdivergencyunendinglydendrologydraggingly
...View all with 10 letters...
Phrases (45)
body weightsugar candysugar daddydry wallingwedding daygreek deityfading awayleydig celllady godivagood old boy
...View all with 10 letters...
Words (257)
accordinglydaydreamingdangerouslyidentifyingexceedinglymethodologyskulduggerycopyrighteddehydratingandrogynousindignantlydeservinglydemagoguerytroglodytessolidifyinggrandiositydisgustedlydelightedlytroglodytichumidifyingdisarminglydyslogistictragicomedyradiographydeafeninglylegendarilydeceivinglydermatologydetoxifyingdenigratoryunfeignedlyconfidinglygrandioselyrigidifyingendearingly
...View all with 11 letters...
Phrases (77)
honey badgergypsum boardlaugh loudlydry cleaningturdus greyiledger entrygrand canyonon your guardhydrogen ionbinary digit
...View all with 11 letters...
Words (227)
triglyceridedelightfullydisgustinglyskullduggerybodybuildingdisturbinglybegrudginglygobbledygookepidemiologyhydrogenateddepressinglydespairinglyresoundinglygroundlesslydiversifyinghypogonadismhydrographicmythologizedprodigiouslycardiomegalyhydroplaninghydrologicaldogmaticallyastoundinglydeoxygenatedcurmudgeonlycardiographyamygdaloidalmisleadinglyunderplayingphagocytosedheterodyningindemnifyingregardlesslyfarsightedly
...View all with 12 letters...
Phrases (100)
woody guthriemary magdalenbody stockingfully fledgeddwight l. moodygenus cydoniasign industrybenny goodmanacid hydrogenfolding money
...View all with 12 letters...
Words (152)
ideologicallydehydrogenasedistressinglydisparaginglydeoxygenationendocrinologydisgracefullyhydrogenationdillydallyingoutstandinglydaguerreotypedisqualifyingadmonishinglydactylographyunderstudyingindefatigablypedagogicallybewilderinglydemythologizeundeviatinglyresolidifyinggerrymanderedundisguisedlygeohydrologicknowledgeablydehumidifyingrekeyboardingupgradabilitydeprecatinglydeclassifyingforesightedlymollycoddlingreidentifyingdissatisfyinggrandmotherly
...View all with 13 letters...
Phrases (109)
neglect of dutyadvocacy groupclyde tombaughhigh-and-mightygenus bradypusdwindling awaydizygotic twincedar mahoganypraying mantiddoughnut fryer
...View all with 13 letters...
Words (120)
demythologiseddiagnosticallydisapprovinglyadvantageouslydemythologizeddisingenuouslydepolymerizinglightheartedlygeohydrologistdiscouraginglydehydrogenasesgreatheartedlydisquantityingupgradeabilityhyperpigmentedintimidatinglyspellbindinglypseudepigraphydaguerreotypeddaguerreotypeshydrobiologieshydrobiologistremythologizeddemoralizinglyadrenergicallyhydrologicallyneuroradiologygerrymanderinggeohydrologiesdemythologizerdemythologizesdehydrogenateddehydrogenatesmisidentifyinggynandromorphs
...View all with 14 letters...
Phrases (107)
lachrymal glandpituitary glandveliky novgoroddrainage systemdizzy gillespieoyster dressingrudyard kiplinganser cygnoidespan troglodytesgenus aleyrodes
...View all with 14 letters...
Words (75)
condescendinglydisappointinglydramaturgicallygynandromorphiccorrespondinglydemographicallyaccommodatinglysidesplittinglydisenchantinglydishearteninglydistinguishablyradioautographydaguerreotypisthydrobiologicaldisconcertinglylepidopterologyunderstandinglygeohydrologistsdemythologizersdemythologizingdehydrogenatingdyslogisticallydehydrogenationhydrometallurgyoveridentifyingdecarboxylatingglutaraldehydesdermatoglyphicsglyceraldehydesgrandiloquentlyxeroradiographyideographicallyautoradiographyoligodendrocytestrongyloidoses
...View all with 15 letters...
Phrases (154)
mail-order buyingwystan hugh audenfamily triglidaeleveraged buyoutdasyprocta agutidoris may lessinggenus dasyproctaantianxiety drugfamily mugilidaedocking facility
...View all with 15 letters...
Words (29)
dendrochronologyparadigmaticallyradiographicallydimethylglyoximelyginopteridalesindefatigabilitydaguerreotypistsstrongyloidiasesstrongyloidiasisoligodendrocytesbiodegradabilityechocardiographydehydrogenationsgynandromorphiesgynandromorphismpalaeodendrologyradiophotographybrightly-colouredhydrometeorologyhiggledy-piggledyethnomethodologymicroradiographycladogeneticallymethodologicallypaedogeneticallydiagrammaticallygynandromorphousknowledgeabilitydiscriminatinglyPhrases (125)
italian greyhoundcardiac glycosidealan lloyd hodgkindwight lyman moodyexemplary damagesyeoman of the guardgenus aptenodytesisland of guernseyorder polygonalesgrand canyon state
...View all with 16 letters...
Words (19)
straightforwardlyradiobiologicallystrongyloidosisessamoyedic-speakingphonocardiographydisadvantageouslygynandromorphismsangiocardiographydephosphorylatinguncomprehendinglyepidemiologicallyhydrometallurgiesdialectologicallyhydrometallurgistdiaphragmaticallydemythologisationdemythologizationdihydroergotamineindistinguishablyPhrases (107)
dame margot fonteynantipsychotic drugcylindrical lininggettysburg addressfamily engraulidaeindependent agencymodest moussorgskygenus dactylorhizagenus phyllocladusivy-leaved geranium
...View all with 17 letters...
Words (11)
distinguishabilityneuroendocrinologydemythologizationspropagandisticallyhydrometallurgicalsedimentologicallyhydrometallurgistshydrometeorologieshydrometeorologistindiscriminatinglydihydroergotaminesPhrases (105)
freudian psychologymegacycle per secondgene delivery vectorarthur garfield hayswedding anniversaryfamily meliphagidaeorder sauropterygialucy maud montgomerydepartment of energydigitalis glycoside
...View all with 18 letters...
Words (6)
magnetohydrodynamicdehydrochlorinatinghydrometeorologicalhydrometeorologistsmedroxyprogesteroneelectrocardiographyPhrases (88)
building supply housefamily cynoglossidaebond-trading activityavogadro's hypothesishydrobates pelagicussolidarity surchargeorder apterygiformesgerard manley hopkinsabo blood group systemglycerinated gelatin
...View all with 19 letters...
Words (3)
indistinguishabilitymagnetofluiddynamicsmagnetohydrodynamicsPhrases (70)
clyde william tombaughclassifying adjectivefamily gasterosteidaeunabridged dictionaryagropyron intermediumbasidiomycetous fungisaturday night specialbernard law montgomerywilliam lloyd garrisonfamily tachyglossidae
...View all with 20 letters...
Words (2)
phosphoglyceraldehydedendrochronologicallyPhrases (55)
soren aabye kierkegaardsamuel taylor coleridgefamily myrmecophagidaesyngnathus hildebrandijohn fitzgerald kennedypercy aldridge graingerorder lyginopteridalesyellow-eyed grass familyandromeda glaucophyllaflexible sigmoidoscopy
...View all with 21 letters...
Words (1)
phosphoglyceraldehydesPhrases (49)
high-density lipoproteinamygdalus communis amaraguided missile destroyerhenry engelhard steinwaydisplaying incompetencetroglodytes troglodytesdoctor of sacred theologyedward kennedy ellingtonmary ludwig hays mccauleydouble-entry bookkeeping
...View all with 22 letters...
Words (1)
electrocardiographicallyPhrases (32)
argyroxiphium sandwicensemary wollstonecraft godwinunidentified flying objectzollinger-ellison syndromedistinguished flying crosstechnology administrationfederal republic of germanyhenry wadsworth longfellowandrei andreyevich gromykopaul johann ludwig von heyse
...View all with 24 letters...
Phrases (19)
igor fyodorovich stravinskydiamond wedding anniversaryfrancis scott key fitzgeraldmodest petrovich mussorgskyedmund john millington syngereligious society of friendssir arthur stanley eddingtonarab revolutionary brigadespodkamennaya tunguska riverdevelopmentally challenged
...View all with 25 letters...
Phrases (15)
brassica oleracea gongylodeshunting and gathering societydorothy mary crowfoot hodgkinsubmandibular salivary glandsubdivision mastigomycotinasystem of weights and measuresentandrophragma cylindricumgilles de la tourette syndromemodest petrovich moussorgskyforce-feed lubricating system
...View all with 26 letters...
Phrases (15)
george percy aldridge graingeraleksandr sergeyevich pushkintricyclic antidepressant drugtopical prostaglandin eyedropequivalent-binary-digit factorlimb-girdle muscular dystrophydeoxyguanosine monophosphatemetasequoia glyptostrodoidesfederal republic of yugoslaviastates' rights democratic party
...View all with 27 letters...
Phrases (1)
canadian security intelligence servicePhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
enzyme-linked-immunosorbent serologic assay
