Words Containing: D,A,Y,A,N
(In Any Order)
There are 558 words,
1,711 phrases and
0 abbr's with
D,A,Y,A,N in.
Best Scoring Words With: D,A,Y,A,N
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| yardman | 7 | 13 | nounn | |||||
noun • worker in a railway yard • a laborer hired to do outdoor work (such as mowing lawns) | ||||||||
| daysman | 7 | 13 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| drayman | 7 | 13 | nounn | |||||
noun • A man who drives drays. • A deliveryman for a brewery. | ||||||||
| lanyard | 7 | 11 | nounn | |||||
noun • a cord with an attached hook that is used to fire certain types of cannon • a cord worn around the neck to hold a knife or whistle • (nautical) a line used for extending or fastening rigging on ships | ||||||||
| tanyard | 7 | 11 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| naysaid | 7 | 11 | verbv | |||||
verb • To speak negatively of something. • To reply no. | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
dayanWords (1)
dayansWords (37)
nowadayslandladyanalyzedmarylandhandymanbarnyardanalysedquandarymandalaydamnablydairymanlanyardsadynamiaadamancyadynamicanodallyradiancytanyardscyanamidasyndetaintradayyardlandyardwandplaylandandryalabandymandrynariadarraynshandplaydrangwayyakhdanscarandaynaywardshaybandsmainyard
...View all with 8 letters...
Phrases (9)
natal dayrainy daydayton axlunar daynavy yardmain yardsend awaycandy barad agencyWords (50)
mandatorycandidacyfairylandhydrangearadiantlyadamantlydamnatoryadjacencyunallayedgrandbabyunarrayedanalysandadrenallynaugahydecyanamidscandygramdilatancydynamicalamygdalingrandaddymandataryadjutancycyanamideunassayedbarnyardsyardlandsstandawayyardwandsadynamiasplaylandsdimyariandecanallyanhydraseindo-aryansynapsida
...View all with 9 letters...
Phrases (10)
in a bad wayman fridaydayton axebaby grandcandy canegrind awaysaint's dayhard candynaked ladycanada jayWords (71)
granddaddychardonnayabundantlyinadequacydiagonallyascendancylaundrymanadenopathyunabatedlytalleyrandpardonablysandpaperyanodicallyanalysandsdamaginglyreanalyzedadjacentlyanimatedlyamendatoryhydrangeasstandardlynaugahydescyanamidesfairylandsshandygaffcandygramsamygdalinsunanalyzedcardinallyadriamycinbrandyballbrandysnapmastodyniaprandiallyaccordancy
...View all with 10 letters...
Phrases (26)
canada lynxmoshe dayancanary birdsugar candyfading awaylay hands onpaddy wagoncarded yarnandy warholcanary seed
...View all with 10 letters...
Words (74)
daydreamingaerodynamicunavoidablyunabashedlyunashamedlydynamicallykinyarwandaanecdotallymandatorilydiaphaneityantidotallyaccordantlyabdominallyglandularlycondylomatacardinalityrhabdomancyundebatablydisarrayingfantasylandshandygaffspachysandraascendantlychardonnayswaywardnesshydralazinepyrovanadicadriamycinsmastodyniasdecanicallyunadvisablyhypnopaedialoadsamoneyhydromaniashochmagandy
...View all with 11 letters...
Phrases (38)
in a broad wayfree-and-easydwindle awaylaundry cartgrand canyondylan thomassan diego bayjudy garlandveterans' daygandy dancer
...View all with 11 letters...
Words (69)
accidentallyadditionallyaerodynamicsinadequatelyscandalouslylaundrywomanunpardonablyoveranalyzedpedanticallyvaletudinaryautoantibodyideationallydiaphanouslyineradicablytraditionaryalloantibodydeflationarypaddywackingsardonicallyfantasylandshydralazinesdemoniacallynoncandidacybackhandedlypachysandrasarchdeaconrydiatonicallydynasticallygeodynamicalhypnopaediasloadsamoneysinfatuatedlydodecagynianbradykinesialymantriidae
...View all with 12 letters...
Phrases (63)
mary magdalenscantily cladascension daygrand larcenyall saints' daydisplay paneladenylic acidways and meansguyana dollarordinary care
...View all with 12 letters...
Words (60)
extraordinaryfundamentallytraditionallyencyclopaediadisparaginglyadrenalectomyeducationallyquadrenniallyindefatigablyhyaluronidaseaerodynamicalanaphylactoidsynarthrodialexpandabilitywaywardnessesdeuteranomalyanecdoticallyaptitudinallyintradermallydevastatinglygrandfatherlyasyndeticallylatitudinallynondialyzablegradationallyattitudinallytetradynamoushydrangeaceaebradykinesiasadiathermancyastrodynamicslymphoadenomaanti-democracydactyliomancyinterradially
...View all with 13 letters...
Phrases (75)
el iskandriyahbattle of pydnauranyl radicaldwindling awaycedar mahoganypraying mantidcanary islandsradiant energyjapanese deitysalivary gland
...View all with 13 letters...
Words (58)
understandablydepartmentallydiagnosticallyadvantageouslypsychoanalyzedfoundationallyhydrodynamicalantidromicallyadrenergicallyfaintheartedlyencyclopaediasaerodynamicistundogmaticallyclairaudientlycyanoethylatedhyaluronidasesundramaticallyadaptationallyplatinocyanidediachronicallyintracardiallyinadvisabilitydiageneticallyunacademicallyunavoidabilitytraditionalityachondroplastymegalonychidaepsychoanalysedcynocephalidaelymphoadenomasaerohydroplanecyanogenamidesactinomyxidianquadrangularly
...View all with 14 letters...
Phrases (109)
lachrymal glandanthony van dyckanthony vandykewilliam tyndalepituitary glandnavy departmentbusman's holidaydrainage systemdata encryptiondynamic balance
...View all with 14 letters...
Words (52)
extraordinarilylymphadenopathyaerodynamicallycardiopulmonarypolyunsaturatedhypochondriacaldispassionatelyaccommodatinglyunextraordinaryunadulteratedlyhydromechanicalsuperabundantlytetrahydrofurandisinflationarycoeducationallyuntraditionallyaerodynamicistsdecarboxylationdecarboxylatingunanticipatedlypharmacodynamicineradicabilityhemodynamicallythermodynamicalplatinocyanideshendecasyllabichendecasyllablehyperadrenalismastrodynamicistlymphoadenomataacknowledgeablydiamagneticallydactyliomanciesheavy-handednessaerohydroplanes
...View all with 15 letters...
Phrases (153)
by fits and startsdialysis machinefamily tinamidaeannunciation dayby trial and errorwystan hugh audenjohn quincy adamsadmiralty islanddiamond jim bradynational holiday
...View all with 15 letters...
Words (27)
administrativelydenominationallyindefatigabilitydecarboxylationsdodecaphonicallypharmacodynamicsheavyheartednessundiplomaticallyadenohypophysealadenohypophysialhendecasyllabicshendecasyllablesphotodynamicallyundemocraticallycryptobranchidaeradioimmunoassayancylostomatidaepalaeodendrologypseudoparenchymahydrodynamicallytranscendentallycalcium-cyanamidelabyrinthodontiacladogeneticallypaedogeneticallyununderstandablytetrahydrofuransPhrases (134)
italian greyhoundfamily cyprinidaealan lloyd hodgkinfamily balaenidaeyeoman of the guardfamily blenniidaequaternary periodgrand canyon stateright to candidacyfamily pythonidae
...View all with 16 letters...
Words (14)
thermodynamicallyradioimmunoassayshypochondriacallyunderstandabilityidiosyncraticallylymphadenopathiestransdisciplinarysamoyedic-speakingphonocardiographyaerothermodynamicdisadvantageouslyangiocardiographypseudoparenchymaspsychodynamicallyPhrases (153)
dame margot fonteyncylinder separatorcaesarian deliverycapital of marylandhereditary patternsanitary conditionsubsidiary companyfamily engraulidaeafrican yellowwoodsubfamily turdinae
...View all with 17 letters...
Words (7)
diethylmalonylureaaerothermodynamicsheavyheartednessespropagandisticallypseudoparenchymatachlamydomonadaceaediethylcarbamazinePhrases (146)
administrative bodydivision anthophytawedding anniversarydylan marlais thomasphoenix dactyliferaeducation secretaryamlodipine besylatedanish monetary unitfamily centriscidaeharold clayton lloyd
...View all with 18 letters...
Words (8)
individualisticallymagnetohydrodynamicpharmacodynamicallyphenylthiocarbamidemercury-contaminatedinterdepartmentallydiethylcarbamazinestetramethyldiarsinePhrases (157)
scandinavian countryfamily cynoglossidaehydrastis canadensisbond-trading activitynancy freeman mitfordcalycanthus floridusdisability insuranceedna st. vincent millaygerard manley hopkinsfundamental quantity
...View all with 19 letters...
Words (7)
tetrahydrocannabinolradioimmunoassayablemagnetofluiddynamicsphenylthiocarbamidesmagnetohydrodynamicsencephalomyocarditispseudoparenchymatousPhrases (136)
honduran monetary unitdevelopmental anatomydivision tracheophytadianthus caryophyllusambystomid salamanderclassifying adjectiveorder actinomycetalesamyloid protein plaqueunabridged dictionaryfamily myrmeleontidae
...View all with 20 letters...
Words (2)
encephalomyocarditisesdihydroxyphenylalaninePhrases (76)
hydrated aluminium oxidealeksandr i. solzhenitsynfamily dendrocolaptidaerhythm and blues musicianfamily branchiostomidaeindonesian monetary unitedna saint vincent millayamygdalus communis amaraparliamentary procedurehenry engelhard steinway
...View all with 22 letters...
Words (1)
phosphatidylethanolaminePhrases (61)
argyroxiphium sandwicensemary wollstonecraft godwinprivately held corporationalexandre emile jean yersinapocynum androsaemifoliumantiarrhythmic medicationalfred edward woodley masontechnology administrationfederal republic of germanysir charles leonard woolley
...View all with 24 letters...
Words (1)
phosphatidylethanolaminesPhrases (43)
embryonal rhabdomyosarcomadiamond wedding anniversaryfrancis scott key fitzgeraldsir arthur stanley eddingtonandrei arsenevich tarkovskysudden infant death syndrometympanuchus pallidicinctusarab revolutionary brigadespodkamennaya tunguska rivernational academy of sciences
...View all with 25 letters...
Phrases (32)
brassica oleracea gongylodeshunting and gathering societysubmandibular salivary glandcharles maurice de talleyrandrevolutionary calendar monthsubdivision basidiomycotinasubdivision mastigomycotinasystem of weights and measuresentandrophragma cylindricumconjunctival layer of eyelids
...View all with 26 letters...
Words (1)
ethylenediaminetetraacetatePhrases (24)
american revolutionary leadergeorge percy aldridge graingeraleksandr sergeyevich pushkinorder of our lady of mount carmeldeoxyadenosine monophosphatesecretary of commerce and labortricyclic antidepressant drugtopical prostaglandin eyedropfalkland islands monetary unitatrioventricular nodal rhythm
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (10)
aleksandr feodorovich kerenskycardiopulmonary resuscitationdepartment of homeland securitydissident irish republican armynonsteroidal anti-inflammatorysocial security administrationerythrocyte sedimentation ratemethamphetamine hydrochloridetime-delay measuring instrumentarmy for the liberation of rwandaWords (1)
methylenedioxymethamphetaminePhrases (18)
aleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemedward george earle bulwer-lyttonmiddle east respiratory syndromeunited arab emirate monetary unithydrangea macrophylla hortensislydia kamekeha paki liliuokalani
...View all with 29 letters...
Phrases (11)
alexander isayevich solzhenitsyndepository financial institutionethylenediaminetetraacetic acidsevere acute respiratory syndromenontricyclic antidepressant drughenri rene albert guy de maupassanttechnical analysis of stock trendsdisseminated lupus erythematosusacute inclusion body encephalitisoccupational safety and health act
...View all with 30 letters...
Phrases (9)
digital communications technology2019-ncov acute respiratory diseaserecombinant deoxyribonucleic acidrichard august carl emil erlenmeyermarie anne charlotte corday d'armontfibrocystic disease of the pancreasovulation method of family planningdefense information systems agencymary godwin wollstonecraft shelleyPhrases (11)
nikolai andreyevich rimski-korsakovsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovnonsteroidal anti-inflammatory drugoculopharyngeal muscular dystrophyyevgeni aleksandrovich yevtushenkofederal emergency management agencyattorney general of the united statesadult respiratory distress syndromejohn f. kennedy international airport
...View all with 32 letters...
Phrases (8)
autonomous sensory meridian responsenondepository financial institutionright to speedy and public trial by jurysecretary of health and human servicessubacute inclusion body encephalitisidiopathic thrombocytopenic purpuraamaranthus hybridus hypochondriacusphysiological jaundice of the newbornPhrases (7)
attention deficit hyperactivity disordergenerally accepted accounting principlessecretary of housing and urban developmentacademy of motion picture arts and scienceskarl friedrich hieronymus von munchhausendefense advanced research projects agencyunited states national library of medicinePhrases (1)
enzyme-linked-immunosorbent serologic assay
