Words Containing: CIE
(In Exact Order)
There are 957 words,
182 phrases and
0 abbr's with
CIE in.
Best Scoring
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| juicier | 7 | 16 | adjectiveadj | |||||
adjective • abounding in juice adjective satellite • having strong sexual appeal • lucrative • suggestive of sexual impropriety | ||||||||
| fancied | 7 | 13 | verb, adjectivev, adj | |||||
adjective satellite • formed or conceived by the imagination | ||||||||
| boccies | 7 | 13 | noun, adjectiven, adj | |||||
noun • Italian bowling played on a long narrow dirt court | ||||||||
| faciend | 7 | 13 | verb, nounv, n | |||||
Valid word for Scrabble US
| ||||||||
| society | 7 | 12 | nounn | |||||
noun • an extended social group having a distinctive cultural and economic organization • a formal association of people with similar interests • the state of being with someone • the fashionable elite | ||||||||
| fancier | 7 | 12 | noun, adjectiven, adj | |||||
noun • a person having a strong liking for something | ||||||||
| boccie | 6 | 12 | noun, adjectiven, adj | |||||
noun • Italian bowling played on a long narrow dirt court | ||||||||
| fancies | 7 | 12 | verbv | |||||
adjective • not plain; decorative or ornamented noun • something many people believe that is false • imagination or fantasy; held by Coleridge to be more casual and superficial than true imagination • a predisposition to like something verb • imagine; conceive of; see in one's mind • have a fancy or particular liking or desire for | ||||||||
| farcies | 7 | 12 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| science | 7 | 11 | nounn | |||||
noun • a particular branch of scientific knowledge • ability to produce solutions in some problem domain | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
cielWords (58)
policiesancientshaciendasocietaljuiciestfanciestpriciestfanciersprecieuxlancierslegaciesdioeciessauciersjouncieridiocieslunaciesacieratebouncieragenciesnescientfaciendscuraciesminciestsciencessauciestspiciestglacierssprucierchancierspaciestabbaciespapaciespiraciesfleecierscienced
...View all with 8 letters...
Words (72)
scientistefficientconciergedeficientfinancierprescientancientlydecenciesnescienceflouncierpotenciesacierateslatenciestruanciesprecieusetenanciessocietiesacieratedspruciestvacancieshaciendasanimacieschanciestardenciesprelaciesabbotciesbounciestlucenciesvalenciesprimaciesscientismscientizeregenciesmonoeciesglaciered
...View all with 9 letters...
Words (119)
consciencescientificsufficientefficiencydeficiencyproficientomniscientsubspeciesgeosciencebioscienceprescienceancientestsolvenciesscientistsefficaciesexigenciesadvocaciestheodiciesobduraciesvagranciesdelegaciespendenciespharmaciesfederaciesadequaciesbrevetciesdelicaciesaccuraciessocietallyvibranciesfeminaciespiquanciesfinancierslenienciesnormalcies
...View all with 10 letters...
Phrases (5)
boccie ballcat fancierprima faciebig sciencescience labWords (166)
efficientlyinefficientproficiencyscientologysufficiencycoefficientomnisciencecotenanciescoherenciesreticenciesfinancieredpurulenciescontumaciesdeficientlyautocraciessubagenciesaberranciesintricaciespoignanciessuperficiesindecenciesconstanciesaffluenciesobstinaciesrenitenciessupremaciesvehemencieshesitanciesindigenciesrubefacientemergenciescandidaciesbaronetciesvirulenciesrecreancies
...View all with 11 letters...
Phrases (10)
ancient pineopen societylife sciencefish speciesglacier lilygracie allenglacier milltype specieshigh societybird fancierWords (203)
sufficientlyinsufficientunscientificinefficiencyproficientlyneuroscienceinterspeciesvalenciennesitineranciesomnisciencesprofligaciesinefficientsnonscientistochlocraciesincumbenciesmalignanciesdivergenciessomnifacientmendicanciespertinenciesprecedenciesbioscientistintersocietyconspiraciesfinancieringreluctanciesepiscopaciesinsolvenciespermanenciesrecumbenciescomplicaciesgeoscientistinclemenciesexpectanciesimmaculacies
...View all with 12 letters...
Phrases (7)
ancient greekancien regimebrain sciencehorse fancierearth scienceroyal societypolar glacierWords (128)
conscientiousinsufficiencyinefficientlypseudoscienceaccountanciesequivalenciesbioscientificcomplacenciesdespondenciesflamboyanciesbureaucraciesprolificaciesnonscientistsinconstanciesproficienciessomnifacientsbioscientistsconfederaciesconvenienciesdiscordanciesmeritocraciesnonscientificcontingenciesirrelevanciesdiscrepanciesstratocraciespersistenciesintersocietalastringenciesinhabitanciessufficienciesabortifacienttotipotenciesconversanciesancientnesses
...View all with 13 letters...
Phrases (8)
life scientistanimal fancierfabian societytribal societysecret societyscience museumalpine glaciersocial scienceWords (86)
scientificallyinsufficientlyneuroscientistcodependenciesimpertinenciesindependenciesextravaganciessignificanciesbelligerenciesincompetenciesresplendenciesimpermanenciestransparenciesconstituenciesradiolucenciesinadvertenciessubservienciesnonresidenciesgerontocraciesabortifacientssuperefficienttranslucenciesnoncandidaciesprecipitancieshyperefficientultraefficientinexpedienciessupersecreciesindifferenciesintermediaciesnonemergenciespredominanciesinarticulaciesconsciencelesspantisocracies
...View all with 14 letters...
Phrases (17)
mass deficiencyscience teacherplant scientistlibrary sciencezinc deficiencysociety of jesusnatural sciencemedical sciencescience fictionapplied science
...View all with 14 letters...
Words (38)
conscientiouslyinconvenienciespseudoscientistindeterminaciesinconsistenciesinsufficienciesintermittenciesgyrofrequenciesneuroscientificpreponderanciesmulticurrenciesneuroscientistsimmunodeficientthalassocraciestranscendenciesrecalcitranciessuperefficiencyconsenescenciesintransigenciesconstringenciesdefervescenciescircumjacenciesrecrudescenciessanguinolenciesconvalescenciestransmittanciesself-sufficiencydactyliomanciesretromingenciesthalattocraciesquadrivalenciesabsorbefacientsdeficientnessesunconscientiouspetrocurrencies
...View all with 15 letters...
Phrases (18)
conscience moneychemical sciencedrag coefficientphysical sciencerocket scientistbuilding societycomputer sciencemaster of sciencesocial scientistcreation science
...View all with 15 letters...
Words (6)
pseudoscientificunscientificallyimmunodeficiencypseudoscientistscorrespondenciesinsignificanciesPhrases (13)
guilty consciencesociety of friendsefficiency expertnatural scientistmedical scientistcognitive sciencescientific theorymental deficiencyvalenciennes lacepolitical science
...View all with 16 letters...
Words (10)
conscientiousnesscounterscientificinterdependenciessuperefficienciesconscience-smittencountertendenciesnonbelligerenciessuperintendenciesoverconscientiouspseudopregnanciesPhrases (14)
biological sciencelactase deficiencyvoice of consciencemendenhall glacierscience laboratorybiomedical sciencecomputer scientistendangered speciesdeficiency diseasezoological science
...View all with 17 letters...
Phrases (1)
acquired immune deficiency syndromePhrases (1)
tetrachoric correlation coefficientPhrases (1)
academy of television arts and sciencesPhrases (1)
product-moment correlation coefficientPhrases (1)
rank-difference correlation coefficient
