Words Containing: C,Y,R
(In Any Order)
There are 7,677 words,
5,166 phrases and
0 abbr's with
C,Y,R in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
exarchy | 7 | 22 | nounn | |||||
Valid word for Scrabble US
| ||||||||
crazily | 7 | 21 | adverbadv | |||||
adverb • in an insane manner | ||||||||
pyrexic | 7 | 21 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
coryzal | 7 | 21 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
coryzas | 7 | 21 | nounn | |||||
noun • an inflammation of the mucous membrane lining the nose (usually associated with nasal discharge) | ||||||||
uncrazy | 7 | 21 | verbv | |||||
Valid word for Scrabble US
| ||||||||
churchy | 7 | 20 | adjectiveadj | |||||
noun • (mildly pejorative) one who is piously Christian adjective • Piously Christian. • Resembling a church. • Reminiscent of a church service. | ||||||||
coryza | 6 | 20 | nounn | |||||
noun • an inflammation of the mucous membrane lining the nose (usually associated with nasal discharge) | ||||||||
crazy | 5 | 19 | adjectiveadj | |||||
noun • someone deranged and possibly dangerous adjective satellite • affected with madness or insanity • foolish; totally unsound • possessed by inordinate excitement • bizarre or fantastic • intensely enthusiastic about or preoccupied with | ||||||||
crybaby | 7 | 19 | nounn | |||||
noun • a person who lacks confidence, is irresolute and wishy-washy • a person given to excessive complaints and crying and whining | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
cryWords (134)
cryingcreepycherrytrickycyborgcrankycanarycrispyclergycreasycraftycreamycypruspiracypriceycrummycelerycrosbycrustyscurrycheerycarneyscrewyscurvycurtsycrannycrayoncrabbyoutcryrichlycyphercrackychirpycreakycrypto
...View all with 6 letters...
Phrases (6)
cry outdry icewar crycry forcy presfar cryWords (296)
countryclearlycenturyfactoryvictorycrystalcharityprivacygroceryscenerycrueltymercurycavalrycharleysecrecyclarifysynchroanarchyclaritycrucifyurgencycrybabychristycarlylemockerysorcerydaycarepricklycutleryscrawnyrecyclecrunchyarcherylarcenycertify
...View all with 7 letters...
Phrases (8)
red clayday caredry cellst. cyrilfry cookcyrus iiback yerwry faceWords (465)
securityrecentlycarryingdirectlyceremonycemeterycontrarysecretlyrecoverystrictlybackyardprophecycourtesycurrencypharmacycategorycowardlymccarthyaccuracycylindermonarchysyracuserhythmicculinaryscarcelyfiercelycoronaryatrocityforciblyscrutinystracheychivalryancestrycoventrytrickery
...View all with 8 letters...
Phrases (25)
dry cleancarry offcarry outhard copycd playerpony cartcooky jarscrew eyescrew keyc battery
...View all with 8 letters...
Words (721)
certainlynecessaryemergencyperfectlycarefullysecretarypreciselydemocracydiscoverycurrentlypregnancycelebritychemistrycorrectlycuriosityfrequencysincerelysecondarycertaintycourtyardmachinerysanctuaryhypocritesinceritymccartneyhypocrisyrecyclingaccessorymercenarydirectorycopyrighthierarchytreacheryradicallycustomary
...View all with 9 letters...
Phrases (77)
salary cutdirect dyechurch keycary granttroy ouncelike crazyready cashcut-and-drygin rickeydry socket
...View all with 9 letters...
Words (956)
incrediblyconspiracymotorcyclescreenplayhystericaldictionarybankruptcycreativitypresidencyvocabularytrajectoryaccuratelytragicallycommentaryironicallycompulsoryhyperspaceinsecuritypsychiatrydiscreetlyblackberrygracefullyhydraulicsindirectlyschoolyardarcheologychardonnayverticallycriticallyforcefullyculturallymediocritygraciouslyskyscraperencryption
...View all with 10 letters...
Phrases (158)
cygnus oloremery clothcarya ovatarailway carcanary birdsugar candypastry cookterry clothcrazy quiltbing crosby
...View all with 10 letters...
Words (1118)
electricitypracticallynecessarilydocumentarycountrysideunnecessarypsychiatriccredibilitycomfortablyaccordinglycontroversyuncertaintycalligraphybeneficiaryreactionaryarchaeologysymmetricalbureaucracymercilesslydrasticallyaristocracyclairvoyantreluctantlypromiscuitychlorophyllsynchronizehyperactivediscrepancycelebratoryhuckleberrypterodactylfranticallyconfederacyincorrectlyvicariously
...View all with 11 letters...
Phrases (210)
crown colonybody processspecial jurydry cleaningfilthy lucrevictoria dayacrylic acidbicycle racebald cypressafrican grey
...View all with 11 letters...
Words (1090)
particularlypsychiatristchristianityincreasinglycontemporarychemotherapydramaticallydisciplinaryrespectfullyconservatorysatisfactoryhypocriticalchoreographyconsiderablymiraculouslysynchronizedhistoricallyproductivityridiculouslyromanticallyartificiallyhystericallyperiodicallybiochemistrytransparencycommerciallytriglycerideaerodynamicsstructurallyartisticallyclytemnestracourageouslyrhythmicallycrystallizedhysterectomy
...View all with 12 letters...
Phrases (261)
chlorophyll amolly pitchermary mccarthycalvary crosschristmas dayacrylic fiberacrylic paintacrylic resinbaby carriagepoetic rhythm
...View all with 12 letters...
Words (900)
unnecessarilytheoreticallycontradictorycomplimentaryradioactivityhieroglyphicschrysanthemumpsychotherapyrealisticallyprecautionarystrategicallyhypochondriaccategoricallyspectacularlyparadoxicallycomparativelycomplementarysarcasticallynitroglycerinstereotypicaluncomfortablysuperficiallydiscretionarypsychosurgeryhyperactivitycontractuallyimperceptiblyconfectioneryidiosyncraticgrammaticallyinterlocutorythyroidectomyenergeticallyparticularityhydroelectric
...View all with 13 letters...
Phrases (328)
harvey cushingaleatory musicdirect antonymbitter hickorynursery schooladvocacy groupbody structurecygnus atratusholy sepulcherholy sepulchre
...View all with 13 letters...
Words (750)
cinematographymetaphoricallyelectronicallyuncontrollablydemocraticallyrespectabilitygeographicallyundersecretarycardiomyopathypancreatectomyastrophysicistunsatisfactorythermodynamicselectrotherapycongratulatorynitroglycerineexcruciatinglyconservativelyparapsychologydiscriminatorypredictabilityclitoridectomycharacterologypsychoneuroticsatisfactorilygeosynchronousnephrotoxicityreproductivelydiscourteouslynarcosynthesismicrochemistryconstructivelyconvertibilityastronomicallyappreciatively
...View all with 14 letters...
Phrases (394)
thoracic cavitylachrymal glandorder mysidaceatubal pregnancytrionyx muticussabbatical yearchurch propertyemergency brakeblackberry bushpolymeric amide
...View all with 14 letters...
Words (544)
psychotherapistsynchronizationdisrespectfullychronologicallysynergisticallycrystallizationparentheticallymicroscopicallyaerodynamicallycardiopulmonarytherapeuticallysynchronisationcontroversiallycytomegalovirusuncomplimentarystereochemistryrecrystallizingencephalographyintrospectivelydramaturgicallylogarithmicallygastronomicallycrystallographyhypochondriacalgynandromorphicarchitecturallycorrespondinglyretrospectivelydemographicallyunceremoniouslyunprecedentedlyinconsideratelyritualisticallyneuropsychiatrypsychiatrically
...View all with 15 letters...
Phrases (424)
auditory ossiclecentaurea cyanusbenefit of clergycharlotte cordayadvisory servicefamily arecaceaeorycteropus aferlycosa tarentulahyoscyamus nigerstonecrop family
...View all with 15 letters...
Words (250)
indiscriminatelypheochromocytomahemorrhoidectomyincomprehensiblycatastrophicallyunpredictabilityimperceptibilityuncompromisinglyjournalisticallyelectromyographycircumstantiallypharmaceuticallythermostaticallysurrealisticallyincontrovertiblythrombocytopeniaelectrochemistryrhabdomyosarcomadendrochronologyphotographicallyparapsychologistconversationallyincorruptibilityneuropsychiatricdiscriminatorilyparadigmaticallypolyelectrolytespornographicallycolorimetricallyjurisdictionallythermometricallyantistrophicallyextracorporeallyparamagneticallyradiographically
...View all with 16 letters...
Phrases (463)
hypodermic needletympanic membranestrictly speakingfamily cyperaceaechristian huygensfamily cyprinidaecapital of hungarywilliam wycherleycardiac glycosidecygnus buccinator
...View all with 16 letters...
Words (169)
counterinsurgencybacteriologicallysuperconductivityanthropologicallyparathyroidectomyperchloroethylenematerialisticallycardiorespiratoryelectrostaticallycontemporaneouslythermodynamicallyphilanthropicallypsychotherapeuticmultidisciplinaryprobabilisticallyinterdisciplinaryhyperreactivitiesself-contradictoryradiobiologicallyisoelectronicallyphysiotherapeuticcercidiphyllaceaepolymorphonuclearthermoperiodicityradioisotopicallyparapsychologistsparasitologicallyspectrophotometryspectroscopicallymonochromaticallyrationalisticallythrombocytopeniashypochondriacallychlortetracyclinepaternalistically
...View all with 17 letters...
Phrases (461)
mary leontyne priceczech monetary unitproteolytic enzymemary mcleod bethunecuban monetary unitclass rhodophyceaecoccygeal vertebralycopus americanussubphylum craniataantipsychotic drug
...View all with 17 letters...
Words (82)
characteristicallyhypercoagulabilitypsychopharmacologyinterchangeabilityneuropsychologicalpolyesterificationspectrofluorometrypolymorphonuclearselectrodynamometerspectroheliographypolyribonucleotidenoncomprehensivelypsychotherapeuticsanthropocentricitycylindrical-stemmedperchloroethyleneslipopolysaccharidestereospecificallycalymmatobacteriumstoichiometricallyautobiographicallyrecrystallizationscounterintuitivelymucopolysaccharidehypercholesteremiasaccharomycetaceaemagnetostrictivelysubmicroscopicallypheochromocytomatageochronologicallydehydrochlorinasesdehydrochlorinateddehydrochlorinatesneuroendocrinologytrichloroethylenes
...View all with 18 letters...
Phrases (475)
bombycilla cedrorunbombycilla garruluseriobotrya japonicalachrymal secretionfreudian psychologygenus styracosaurusperomyscus leucopuscolumbia universitymary wollstonecraftread-only memory chip
...View all with 18 letters...
Words (64)
hydrochlorothiazidecinematographicallypolyesterificationsextralinguisticallypolyribonucleotideshypersusceptibilityparathyroidectomiesparthenogeneticallycrosslinguisticallynonrelativisticallymucopolysaccharideslipopolysaccharidescytodifferentiationimmunocytochemistrybacteriochlorophyllmagnetohydrodynamicpharmacodynamicallyphenylthiocarbamidechromatographicallyechoencephalographydehydrochlorinatingdehydrochlorinationmercury-contaminatedelectrodynamometersinterconvertibilitychromoblastomycosiselectromagneticallycontradistinctivelyelectromechanicallyinterferometricallycross-linguisticallyimpressionisticallyelectrophoreticallymethylcholanthreneselectrophysiologies
...View all with 19 letters...
Phrases (371)
family cyclopteridaescandinavian countryseventeen-year locusthydrastis canadensismillimeter of mercuryclass polyplacophoraalpine type of glaciergiles lytton stracheyphytolacca americanafamily dasyproctidae
...View all with 19 letters...
Words (40)
counterrevolutionaryuncharacteristicallyhypercholesterolemiaoverenthusiasticallytetrahydrocannabinolparathyroidectomizedlipochondrodystrophycrystallographicallyhyperadrenocorticismcytodifferentiationsbacteriochlorophyllsphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsneurophysiologicallyneuropsychiatricallyphotoautotrophicallymagnetohydrodynamicsiodochlorhydroxyquinultramicroscopicallyelectrophysiologicalelectrophysiologistsdeoxyribonucleotidesmicrocrystallinitiesimmunohistochemistryroentgenographicallyencephalomyocarditischemotherapeuticallypseudoparenchymatoushydrochlorothiazidespsychopharmacologiesmicrophotometricallypsychopharmacologistsyncategorematically
...View all with 20 letters...
Phrases (344)
yellow-shafted flickerorder mycelia steriliaorder myxobacterialesfamily trachipteridaeoryctolagus cuniculusmarchantia polymorphadivision tracheophytafamily dermochelyidaedianthus caryophyllussuricata tetradactyla
...View all with 20 letters...
Words (15)
psychopharmacologicalhypersusceptibilitiesstereomicroscopicallyimmunocytochemistriesmucopolysaccharidosisacetylcholinesterasesphosphoglyceraldehydeelectromyographicallydendrochronologicallyphotolithographicallyantiferromagneticallyhypercholesterolemiaspsychopharmacologistspsychotherapeuticallytetrahydrocannabinolsPhrases (248)
icelandic monetary unitelectrolytic condenserigor ivanovich sikorskyhelichrysum bracteatumdesoxyribonucleic acidextrauterine pregnancybyzantine architectureeucalyptus fraxinoidesextremely low frequencyginglymostoma cirratum
...View all with 21 letters...
Words (9)
spectrophotometricallyintercomprehensibilityelectroencephalographyphosphoglyceraldehydesotorhinolaryngologicalcarboxymethylcelluloseelectrophysiologicallyencephalomyocarditisesmicrospectrophotometryPhrases (211)
lycopersicon esculentumhaliaeetus leucorhyphustrazodone hydrochlorideaccessory before the factfamily dendrocolaptidaeloyalist volunteer forcesubfamily bassariscidaerhythm and blues musiciancrescent city connectionmale reproductive system
...View all with 22 letters...
Words (2)
hydrochlorofluorocarboncarboxymethylcellulosesPhrases (164)
george macaulay trevelyanmeperidine hydrochloridethryothorus ludovicianusinterlocutory injunctioneuropean recovery programcanyonlands national parkdorothy rothschild parkerrichard brinsley sheridansciadopitys verticillatatricyclic antidepressant
...View all with 23 letters...
Words (4)
laryngotracheobronchitiselectrocardiographicallymicroelectrophoreticallyschizosaccharomycetaceaePhrases (119)
carnegie mellon universityargyroxiphium sandwicensesubdivision deuteromycotasubphylum cephalochordatamary wollstonecraft godwinprivately held corporationprimary sex characteristicsir terence mervyn rattiganbrassica oleracea botrytisdistinguished flying cross
...View all with 24 letters...
Words (1)
immunoelectrophoreticallyPhrases (88)
embryonal rhabdomyosarcomaigor fyodorovich stravinskymary wollstonecraft shelleyfrancis scott key fitzgeraldsymphoricarpos orbiculatuscentral intelligence agencymodest petrovich mussorgskypropoxyphene hydrochloridepolystichum acrostichoidesmelanerpes erythrocephalus
...View all with 25 letters...
Phrases (68)
brassica oleracea gongylodeshunting and gathering societydorothy mary crowfoot hodgkinhuman immunodeficiency virussecretary of veterans affairsemployee stock ownership planassyrian neo-aramaic languagecharles maurice de talleyrandrevolutionary calendar monthsubdivision coniferophytina
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (54)
american revolutionary leadernikita sergeyevich khrushchevholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinorder of our lady of mount carmelco-operative republic of guyanacommissioned military officernuclear regulatory commissionsecretary of commerce and labor
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (42)
aleksandr feodorovich kerenskyephippiorhynchus senegalensistriphosphopyridine nucleotideoxytetracycline hydrochloridemarcus junius brutus the youngerfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationmicrosoft disk operating systemfeodor mikhailovich dostoevsky
...View all with 28 letters...
Phrases (26)
aleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitscrutin uninominal voting systeminternational olympic committeehydrangea macrophylla hortensisultrasonic pulse velocity tester
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (24)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalitybachelor of arts in library sciencedepartment of energy intelligencedepository financial institutionethylenediaminetetraacetic acidbalance of international paymentswaterhouse-friderichsen syndrome
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (18)
2019-ncov acute respiratory diseasetupac amaru revolutionary movementrevolutionary proletarian nucleusport-access coronary bypass surgeryprimary subtractive color for lightrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyerinternational atomic energy agencymarie anne charlotte corday d'armontinternational intelligence agency
...View all with 31 letters...
Phrases (21)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylateuniversity of california at berkeleyprimary subtractive colour for light
...View all with 32 letters...
Phrases (14)
lycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometersecretary of health and human serviceshighly active antiretroviral therapyinternational law enforcement agencycapital: critique of political economy
...View all with 33 letters...
Phrases (8)
secretary of state for the home departmentangiotensin-converting enzyme inhibitorchurch of jesus christ of latter-day saintsjuan carlos victor maria de borbon y borbonfield-sequential color television systemtransportation security administrationsecretary of health education and welfaresocialist people's libyan arab jamahiriyaPhrases (13)
severe combined immunodeficiency diseaseuniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and scienceskarl friedrich hieronymus von munchhausendefense advanced research projects agency
...View all with 37 letters...
Phrases (1)
enzyme-linked-immunosorbent serologic assay