Words Containing: C,L,R,Y
(In Any Order)
There are 3,970 words,
3,243 phrases and
0 abbr's with
C,L,R,Y in.
Best Scoring Words With: C,L,R,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
crazily | 7 | 21 | adverbadv | |||||
adverb • in an insane manner | ||||||||
coryzal | 7 | 21 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
freckly | 7 | 19 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
prickly | 7 | 18 | adjectiveadj | |||||
adjective satellite • very irritable • having or covered with protective barbs or quills or spines or thorns or setae etc. | ||||||||
crackly | 7 | 18 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
chromyl | 7 | 17 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
cyclery | 7 | 17 | nounn | |||||
Valid word for Scrabble US
| ||||||||
crumbly | 7 | 16 | adjectiveadj | |||||
adjective satellite • easily broken into small fragments or reduced to powder | ||||||||
crinkly | 7 | 16 | adjectiveadj | |||||
adjective satellite • uneven by virtue of having wrinkles or waves | ||||||||
crumply | 7 | 16 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (76)
clearlycrystalcrueltycavalrycharleyclarifyclaritycarlylepricklycutleryrecyclelarcenycruellylyricalcalgarycrazilycalvaryacrylicpyloriclecherycrumblycrosslycrudelytreaclycourtlycracklyscarilyfrecklyerectlycrisplycrinklyclerisyclysterciliaryactorly
...View all with 7 letters...
Phrases (3)
red claydry cellst. cyrilWords (165)
recentlydirectlysecretlystrictlycowardlycylinderculinaryscarcelyfiercelyforciblychivalrytricyclesecurelycleverlyliteracyclaymorenormalcyraciallylyricistprincelyscullerycovertlycrediblycarryallcyrillicglycerinscragglyclearwayfalconrycheerilycravenlyalacritycollierylyricismgarlicky
...View all with 8 letters...
Phrases (6)
dry cleancd playerlady crabeye colorcorn lilycrane flyWords (263)
certainlyperfectlycarefullypreciselycurrentlycelebritycorrectlysincerelyrecyclingradicallyhydraulicclergymanchernobylcuriouslyscholarlyolfactorycordiallyoligarchyparalyticcruciallyancillaryglycerinecentrallychrysaliscapillaryrascalitycredulityelectrifylyricallycorollaryplayactorchorologychandlerycatalyzertricyclic
...View all with 9 letters...
Phrases (27)
salary cutlike crazyreal mccoycrazy gluehenry clayhenry lucelayer caketray clothcivil yeardry cereal
...View all with 9 letters...
Words (397)
incrediblymotorcyclescreenplayhystericalvocabularyaccuratelytragicallyironicallycompulsorydiscreetlyblackberrygracefullyhydraulicsindirectlyschoolyardarcheologyverticallycriticallyforcefullyculturallygraciouslysurgicallybricklayercarelesslycreativelyrecklesslycriminallycheerfullynarcolepsyjocularitytyrannicallachrymosecharminglychronologyheroically
...View all with 10 letters...
Phrases (61)
cygnus oloremery clothrailway carterry clothcrazy quiltst. polycarpglyptic arttrolley cargrace kellyroyal court
...View all with 10 letters...
Words (516)
electricitypracticallynecessarilycredibilitycomfortablyaccordinglycalligraphyarchaeologysymmetricalmercilesslydrasticallyclairvoyantreluctantlychlorophyllcelebratoryhuckleberrypterodactylfranticallyincorrectlyvicariouslypyroclasticcriminologyprincipallycrystallinelaparoscopyorganicallyferociouslyirrevocablycirculatorycriminalityerraticallychronicallypredictablychancelleryvaledictory
...View all with 11 letters...
Phrases (91)
crown colonyspecial jurydry cleaningfilthy lucreacrylic acidbicycle racebald cypresslaundry cartboulder claypolicy maker
...View all with 11 letters...
Words (598)
particularlyincreasinglydramaticallydisciplinaryrespectfullyhypocriticalconsiderablymiraculouslyhistoricallyridiculouslyromanticallyartificiallyhystericallyperiodicallycommerciallytriglyceridestructurallyartisticallyclytemnestracourageouslyrhythmicallycrystallizedasymmetricalrespectivelyelectrifyinghieroglyphicincoherentlyelectricallyhypochloritehydrochloricterrificallypharmacologyclairvoyanceconstabularyinextricably
...View all with 12 letters...
Phrases (136)
chlorophyll amolly pitchercalvary crossacrylic fiberacrylic paintacrylic resinwatch crystaldevil-may-caredramatic playsalivary duct
...View all with 12 letters...
Words (566)
unnecessarilytheoreticallycomplimentaryhieroglyphicsrealisticallystrategicallycategoricallyspectacularlyparadoxicallycomparativelycomplementarysarcasticallynitroglycerinstereotypicaluncomfortablysuperficiallycontractuallyimperceptiblygrammaticallyinterlocutoryenergeticallyparticularityhydroelectricsymmetricallyhallucinatoryhydrochloridehydraulicallyprovocativelytheatricalityeccentricallyhydrocephalushypercalcemiaparabolicallyadrenalectomypatriotically
...View all with 13 letters...
Phrases (161)
aleatory musicnursery schoolholy sepulcherholy sepulchreuranyl radicalacrylate resinfactor analysecanary islandsfactor analyzetubular cavity
...View all with 13 letters...
Words (497)
metaphoricallyelectronicallyuncontrollablydemocraticallyrespectabilitygeographicallyelectrotherapycongratulatorynitroglycerineexcruciatinglyconservativelyparapsychologypredictabilityclitoridectomycharacterologysatisfactorilyreproductivelydiscourteouslyconstructivelyconvertibilityastronomicallyappreciativelysuperficialitychlorophyllousinconsiderablyelectromyogramaltruisticallyorthopedicallyasynchronouslyimpracticalityarchetypicallybiographicallyreconciliatoryastrologicallydirectionality
...View all with 14 letters...
Phrases (215)
lachrymal glandtubal pregnancysabbatical yearblackberry bushpolymeric amidecarya laciniosalacrosse playercanterbury bellchinese parsleyoriental cherry
...View all with 14 letters...
Words (379)
disrespectfullychronologicallysynergisticallycrystallizationparentheticallymicroscopicallyaerodynamicallycardiopulmonarytherapeuticallycontroversiallycytomegalovirusuncomplimentaryrecrystallizingencephalographyintrospectivelydramaturgicallylogarithmicallygastronomicallycrystallographyhypochondriacalarchitecturallycorrespondinglyretrospectivelydemographicallyunceremoniouslyunprecedentedlyinconsideratelyritualisticallypsychiatricallycomprehensivelyvoyeuristicallysymmetricalnessperpendicularlyoxytetracyclineagranulocytosis
...View all with 15 letters...
Phrases (239)
auditory ossiclebenefit of clergycharlotte cordayfamily arecaceaelycosa tarentulastonecrop familyjoyce carol oatesscholarly personflannery o'connorcanterbury tales
...View all with 15 letters...
Words (181)
indiscriminatelyincomprehensiblycatastrophicallyunpredictabilityimperceptibilityuncompromisinglyjournalisticallyelectromyographycircumstantiallypharmaceuticallythermostaticallysurrealisticallyincontrovertiblyelectrochemistrydendrochronologyphotographicallyparapsychologistconversationallyincorruptibilitydiscriminatorilyparadigmaticallypolyelectrolytespornographicallycolorimetricallyjurisdictionallythermometricallyantistrophicallyextracorporeallyparamagneticallyradiographicallytrinitroglycerincommensurabilityhypersomnolencespolyrhythmicallythermoplasticity
...View all with 16 letters...
Phrases (285)
hypodermic needlestrictly speakingfamily cyperaceaefamily cyprinidaecapital of hungarywilliam wycherleycardiac glycosidebluegrass countrypodocarpus familycommercial agency
...View all with 16 letters...
Words (125)
bacteriologicallyanthropologicallyperchloroethylenematerialisticallyelectrostaticallycontemporaneouslythermodynamicallyphilanthropicallymultidisciplinaryprobabilisticallyinterdisciplinaryself-contradictoryradiobiologicallyisoelectronicallycercidiphyllaceaepolymorphonuclearradioisotopicallyparapsychologistsparasitologicallyspectroscopicallymonochromaticallyrationalisticallyhypochondriacallychlortetracyclinepaternalisticallyarchitectonicallyferrimagneticallymorphogeneticallylexicographicallycryptocrystallineidiosyncraticallycrystallographerscrystallographiesmicropaleontologydisrespectability
...View all with 17 letters...
Phrases (304)
mary leontyne priceproteolytic enzymemary mcleod bethuneclass rhodophyceaecoccygeal vertebralycopus americanussubphylum craniatacylinder separatorcylindrical liningcommercial bribery
...View all with 17 letters...
Words (67)
characteristicallyhypercoagulabilitypsychopharmacologyinterchangeabilityneuropsychologicalpolyesterificationspectrofluorometrypolymorphonuclearselectrodynamometerspectroheliographypolyribonucleotidenoncomprehensivelycylindrical-stemmedperchloroethyleneslipopolysaccharidestereospecificallycalymmatobacteriumstoichiometricallyautobiographicallyrecrystallizationscounterintuitivelymucopolysaccharidehypercholesteremiamagnetostrictivelysubmicroscopicallygeochronologicallydehydrochlorinasesdehydrochlorinateddehydrochlorinatesneuroendocrinologytrichloroethylenesoscillographicallygranulocytopoiesesspectrographicallygranulocytopoiesis
...View all with 18 letters...
Phrases (314)
bombycilla cedrorunbombycilla garruluslachrymal secretionfreudian psychologyperomyscus leucopuscolumbia universitymary wollstonecraftread-only memory chipkilocycle per secondfamily trichechidae
...View all with 18 letters...
Words (54)
hydrochlorothiazidecinematographicallypolyesterificationsextralinguisticallypolyribonucleotideshypersusceptibilityparthenogeneticallycrosslinguisticallynonrelativisticallymucopolysaccharideslipopolysaccharidesbacteriochlorophyllpharmacodynamicallyphenylthiocarbamidechromatographicallyechoencephalographydehydrochlorinatingdehydrochlorinationelectrodynamometersinterconvertibilitychromoblastomycosiselectromagneticallycontradistinctivelyelectromechanicallyinterferometricallycross-linguisticallyimpressionisticallyelectrophoreticallymethylcholanthreneselectrophysiologieselectrophysiologistdeoxyribonucleotideanthropocentricallyanthropomorphicallyelectroretinography
...View all with 19 letters...
Phrases (260)
family cyclopteridaeseventeen-year locustmillimeter of mercuryclass polyplacophoraalpine type of glaciergiles lytton stracheyphytolacca americanafamily dasyproctidaecapital of kyrgyzstancalycanthus floridus
...View all with 19 letters...
Words (32)
counterrevolutionaryuncharacteristicallyhypercholesterolemiaoverenthusiasticallytetrahydrocannabinollipochondrodystrophycrystallographicallybacteriochlorophyllsphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsneurophysiologicallyneuropsychiatricallyphotoautotrophicallyiodochlorhydroxyquinultramicroscopicallyelectrophysiologicalelectrophysiologistsdeoxyribonucleotidesmicrocrystallinitiesroentgenographicallyencephalomyocarditischemotherapeuticallyhydrochlorothiazidespsychopharmacologiesmicrophotometricallypsychopharmacologistsyncategorematicallyhypercholesterolemichypercoagulabilitiesplethysmographicallyPhrases (254)
yellow-shafted flickerorder mycelia steriliaorder myxobacterialesfamily trachipteridaeoryctolagus cuniculusmarchantia polymorphafamily dermochelyidaedianthus caryophyllussuricata tetradactylamagnetic bubble memory
...View all with 20 letters...
Words (14)
psychopharmacologicalhypersusceptibilitiesstereomicroscopicallymucopolysaccharidosisacetylcholinesterasesphosphoglyceraldehydeelectromyographicallydendrochronologicallyphotolithographicallyantiferromagneticallyhypercholesterolemiaspsychopharmacologistspsychotherapeuticallytetrahydrocannabinolsPhrases (189)
icelandic monetary unitelectrolytic condenserhelichrysum bracteatumdesoxyribonucleic acideucalyptus fraxinoidesextremely low frequencyginglymostoma cirratumcolombian monetary unitarctostaphylos uva-ursispectroscopic analysis
...View all with 21 letters...
Words (8)
spectrophotometricallyintercomprehensibilityelectroencephalographyphosphoglyceraldehydesotorhinolaryngologicalcarboxymethylcelluloseelectrophysiologicallyencephalomyocarditisesPhrases (167)
lycopersicon esculentumhaliaeetus leucorhyphustrazodone hydrochloridefamily dendrocolaptidaeloyalist volunteer forcesubfamily bassariscidaerhythm and blues musicianmale reproductive systembrachycome iberidifoliafamily branchiostomidae
...View all with 22 letters...
Words (2)
hydrochlorofluorocarboncarboxymethylcellulosesPhrases (129)
george macaulay trevelyanmeperidine hydrochloridethryothorus ludovicianusinterlocutory injunctioncanyonlands national parkdorothy rothschild parkerrichard brinsley sheridansciadopitys verticillatatricyclic antidepressantmcguffey eclectic readers
...View all with 23 letters...
Words (3)
laryngotracheobronchitiselectrocardiographicallymicroelectrophoreticallyPhrases (80)
carnegie mellon universitysubphylum cephalochordatamary wollstonecraft godwinprivately held corporationbrassica oleracea botrytisdistinguished flying crossapocynum androsaemifoliumfluoxetine hydrocholoridetechnology administrationfederal republic of germany
...View all with 24 letters...
Words (1)
immunoelectrophoreticallyPhrases (67)
embryonal rhabdomyosarcomamary wollstonecraft shelleyfrancis scott key fitzgeraldsymphoricarpos orbiculatuscentral intelligence agencypropoxyphene hydrochloridepolystichum acrostichoidesmelanerpes erythrocephalusreligious society of friendscaulophyllum thalictroides
...View all with 25 letters...
Phrases (48)
brassica oleracea gongylodesemployee stock ownership planassyrian neo-aramaic languagecharles maurice de talleyrandrevolutionary calendar monthbureau of diplomatic securityentandrophragma cylindricumbenign prostatic hyperplasiamyrtillocactus geometrizansair force research laboratory
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (42)
american revolutionary leaderholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinorder of our lady of mount carmelco-operative republic of guyanacommissioned military officernuclear regulatory commissionsecretary of commerce and labortricyclic antidepressant drug
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (32)
aleksandr feodorovich kerenskyephippiorhynchus senegalensistriphosphopyridine nucleotideoxytetracycline hydrochloridefyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationfeodor mikhailovich dostoevskydepartment of homeland securitymaster of arts in library science
...View all with 28 letters...
Phrases (20)
aleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderscrutin uninominal voting systeminternational olympic committeehydrangea macrophylla hortensisultrasonic pulse velocity testerfrancisco jose de goya y lucientestheory of punctuated equilibriumfyodor mikhailovich dostoyevsky
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (21)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalitybachelor of arts in library sciencedepartment of energy intelligencedepository financial institutionethylenediaminetetraacetic acidbalance of international paymentspolymonium caeruleum van-bruntiae
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (13)
tupac amaru revolutionary movementrevolutionary proletarian nucleusprimary subtractive color for lightrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyerinternational atomic energy agencymarie anne charlotte corday d'armontinternational intelligence agencymarine corps intelligence activityvladimir vladimirovich mayakovski
...View all with 31 letters...
Phrases (15)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylateuniversity of california at berkeleyprimary subtractive colour for lighttheory of electrolytic dissociation
...View all with 32 letters...
Phrases (11)
lycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometersecretary of health and human serviceshighly active antiretroviral therapyinternational law enforcement agencycapital: critique of political economy
...View all with 33 letters...
Phrases (9)
university of north carolina at chapel hillgenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratorykarl friedrich hieronymus von munchhausenus army criminal investigation laboratorysixteen personality factor questionnaireunited states national library of medicinePhrases (1)
enzyme-linked-immunosorbent serologic assay