Words Containing: C,I,I,K,L,L
(In Any Order)
There are 72 words,
225 phrases and
0 abbr's with
C,I,I,K,L,L in.
Best Scoring Words With: C,I,I,K,L,L
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| killick | 7 | 17 | nounn | |||||
noun • A small anchor. • A kind of anchor formed by a stone enclosed by pieces of wood fastened together. • The fluke of such an anchor. • A leading seaman, who wears a badge with an anchor emblem. | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
killickWords (18)
folkloristickilocaloriesblacklistingblackmailingflickeringlylickspittlesrockabilliessk-ampicillinpickadilliespickadilloeskillikinicksrollickinglyflickertailskilometricalclinker-builtalkalimetricbillstickersbillstickingPhrases (7)
lickety splitpickle relishwilliam clarkcicada killernickel silvermercy killingdigital clockWords (6)
lackadaisicallykinestheticallychildlikenessestelekineticallykaleidoscopicalmetallic-lookingPhrases (16)
contract killingscribbling blockalbizzia lebbeckwild bill hickockbiological clockpocket billiardswilliam mckinleylogical thinkingwilliam shockleyalpine milk vetch
...View all with 15 letters...
Phrases (1)
prince otto eduard leopold von bismarckPhrases (1)
enzyme-linked-immunosorbent serologic assayPhrases (1)
international relations and security network
