Words Containing: C,D,K,Y
(In Any Order)
There are 137 words,
216 phrases and
0 abbr's with
C,D,K,Y in.
Best Scoring Words With: C,D,K,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
keycard | 7 | 17 | nounn | |||||
noun • a plastic card that has a magnetically coded strip that is scanned in order to operate a mechanism | ||||||||
dickeys | 7 | 17 | nounn | |||||
noun • a small third seat in the back of an old-fashioned two-seater • a man's detachable insert (usually starched) to simulate the front of a shirt adjective satellite • (British informal) faulty | ||||||||
dickey | 6 | 16 | nounn | |||||
noun • a small third seat in the back of an old-fashioned two-seater • a man's detachable insert (usually starched) to simulate the front of a shirt adjective satellite • (British informal) faulty | ||||||||
drecky | 6 | 16 | adjectiveadj | |||||
adjective • Trashy, worthless | ||||||||
yucked | 6 | 16 | verb, adjectivev, adj | |||||
verb • To itch. | ||||||||
yocked | 6 | 16 | ||||||
Valid word for Scrabble US
| ||||||||
yacked | 6 | 16 | verbv | |||||
noun • noisy talk verb • talk incessantly and tiresomely | ||||||||
ducky | 5 | 15 | adjectiveadj | |||||
noun • a special loved one | ||||||||
dicky | 5 | 15 | noun, adjectiven, adj | |||||
noun • a small third seat in the back of an old-fashioned two-seater • a man's detachable insert (usually starched) to simulate the front of a shirt adjective satellite • (British informal) faulty | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (26)
yardstickdoohickeyhackneyedstockyardalackadaycuckoldrybrickyardcrookedlyskyjackeddockyardsblackbodypaddywackphysickedshylockedbackyardscopydesksbodycheckcuckoldlyyeldrockslaybackedcandy-likestackyarddicky-birddicky-seatdickybirdrickyardsPhrases (6)
dry socketruddy duckblack bodyrock candycandy kisssticky endWords (29)
paddywhackdyskineticbackwardlybrickyardsyardstickscockeyedlykeypuncheddoohickeyspaddywacksflyspeckedswaybackedbackwoodsystockyardsbodycheckshydrocrackdisk-jockeylackadaisypickadillycockneydomcandymakercankeredlydickybirdsdickey-birddickey-seatdickeybirdstackyardsdisc-jockeyrock-steadyrocksteadyPhrases (14)
red buckeyedirty tricklucky lindylady's smockyellow dockcold turkeypancake daysleepy dickdark comedycommand key
...View all with 10 letters...
Words (16)
piggybackedskyrocketedbodycheckedoutjockeyedcockneyfiedpaddywackedunhackneyedhydrocracksspiny-backedchickabiddycockneydomspaddywhacksready-cookeddickeybirdsrosy-cheekedquick-dryingPhrases (11)
dirty tricksmuscovy duckfield hockeychicken yarddyer's rocketblack comedycape kennedydick fosburyjack dempseyjack kennedy
...View all with 11 letters...
Words (13)
hydrocrackedcockeyednesspaddywackingblackguardlyhydrokineticbodycheckingbackhandedlyhydrocrackerstickybeakedhoneysuckleddusky-coloredhydraulickedmusky-scentedPhrases (16)
body stockingalkyl radicalback of beyonddavy crockettdonkey jacketblack-eyed peadarryl zanuckmary pickfordcylinder locklaundry truck
...View all with 12 letters...
Words (9)
hydrocrackinghydrocrackerskitty-corneredblockheadedlyhydrokineticsdusky-colouredhydraulickingprickly-leafedprickly-leavedPhrases (15)
nook and crannyrichard leakeydarryl f. zanuckcylinder blockready reckonerst patrick's daylatchkey childbig-bud hickorycheckered lilysydney pollack
...View all with 13 letters...
Phrases (1)
technical analysis of stock trendsPhrases (1)
vladimir vladimirovich mayakovskiPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assayPhrases (1)
international relations and security network