Words Containing: C,D,E,I,Y
(In Any Order)
There are 1,262 words,
1,785 phrases and
0 abbr's with
C,D,E,I,Y in.
Best Scoring Words With: C,D,E,I,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
dickeys | 7 | 17 | nounn | |||||
noun • a small third seat in the back of an old-fashioned two-seater • a man's detachable insert (usually starched) to simulate the front of a shirt adjective satellite • (British informal) faulty | ||||||||
dickey | 6 | 16 | nounn | |||||
noun • a small third seat in the back of an old-fashioned two-seater • a man's detachable insert (usually starched) to simulate the front of a shirt adjective satellite • (British informal) faulty | ||||||||
mediacy | 7 | 15 | nounn | |||||
noun • the quality of being mediate | ||||||||
cyanide | 7 | 13 | nounn | |||||
noun • any of a class of organic compounds containing the cyano radical -CN • an extremely poisonous salt of hydrocyanic acid | ||||||||
ecdysis | 7 | 13 | nounn | |||||
noun • periodic shedding of the cuticle in arthropods or the outer skin in reptiles | ||||||||
cindery | 7 | 13 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
edacity | 7 | 13 | nounn | |||||
noun • excessive desire to eat • extreme gluttony | ||||||||
dioecy | 6 | 12 | adverb, nounadv, n | |||||
Valid word for Scrabble US
| ||||||||
dicey | 5 | 11 | adjectiveadj | |||||
adjective satellite • of uncertain outcome; especially fraught with risk | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
diceyWords (44)
directlycylinderdelicacydyslexiceurydicecitywidewickedlycrediblycytidinecopyeditcityfieddecoyingcyanidesdecryingdecayingmyceloidsyndeticdocilelybicycledecdysialtheodicycyanidedgynecoidrecodifydysgenicdeviancydyspneicdiacetylcyclizedadenyliccydippeamickeyeddecisorydysmeliccyanised
...View all with 8 letters...
Phrases (2)
basic dyecity deskWords (84)
discoverysyndicatedirectorymedicallyresidencyexcitedlydecidedlyindecencyayurvedicglycosidecredulitydoohickeyimmediacydysgenicsmendacitydyspepticfecunditycordylinedyslecticstridencymendicitydecertifyglyceridedeclivityimpudencyadipocytecylindersunicycledindigencydeacidifycopyeditslyricisedreduciblydecimallypyodermic
...View all with 9 letters...
Phrases (5)
direct dyede quinceyrice paddydodge citysticky endWords (131)
incrediblypresidencydiscreetlydeficiencyindirectlymediocrityincendiarydelicatelysyndicatedinadequacydiscretelycountywidedecisivelyhypodermicindecentlyepicondyledecryptionexpediencycyclopediadeclassifyindulgencythucydidesdespicablyindelicacypellucidlymendicancydivergencycyclopedicacrylamidedyskineticadipocytesimmoderacydecryptingayurvedicsglycerides
...View all with 10 letters...
Phrases (16)
leydig cellcopy editoroxygen acidbird cherrybinary coderiver clydeeye dialectcyanine dyebigeye scadcity editor
...View all with 10 letters...
Words (174)
countrysidecredibilityexceedinglypsychedelicdelinquencyconfidentlydiscrepancyaerodynamicdeliciouslydeceitfullydeceptivelycopyrightedpredictablyvaledictorydoxycyclineseductivelypsychedeliaincredulitymelodicallyrediscoverydiscourtesyidenticallydomesticityhemodynamicsecondarilycomedicallytragicomedycountrywidemedicinallydeceivinglyconceitedlyperiodicitycountryfieddicotyledoncyclopaedia
...View all with 11 letters...
Phrases (24)
dry cleaningcurly endivedisplay casecome in handycopy editingceltic deityfield hockeyconey islandgrey catbirdchicken yard
...View all with 11 letters...
Words (191)
accidentallyincidentallyconsiderablyencyclopediasynchronizedperiodicallytriglycerideaerodynamicscrystallizedacademicallydomesticallymethodicallysynchronisedhyperaciditypolicyholdercoincidentlyencyclopedicindelicatelyindiscreetlycardiomegalypseudocyesisinadvertencyferricyanideindependencycrystallisedproductivelypedanticallydepreciatorydiscursivelymendaciouslydenunciatorycreditworthypolypeptidiccountrysidesindecisively
...View all with 12 letters...
Phrases (47)
chinese deityascension daygenus cydoniadevil-may-careacid hydrogensemitic deitycare deliveryrichard e. byrdcyanide groupcandy striper
...View all with 12 letters...
Words (196)
ideologicallydiscretionaryencyclopaediathyroidectomyhydroelectrichydrochlorideeducationallydistinctivelyendocrinologyincredulouslythermodynamicdiametricallyindescribablydisgracefullyindeterminacyendolymphaticconsideratelyhydrocephalicencyclopaedicunpredictablycreditabilityclandestinelyradioactivelydiscreditablypedagogicallyencyclopedistbasidiomycetedelectabilityencyclopediasgeohydrologicprejudiciallycompendiouslydysmenorrheicaerodynamicaldeprecatingly
...View all with 13 letters...
Phrases (68)
direct antonymfamily picidaedata hierarchycretan dittanygenus dactylisforbidden citybenzyl radicalcelestial bodyrichard leakeylatency period
...View all with 13 letters...
Words (159)
coincidentallydemocraticallyconfidentiallythermodynamicspredictabilityclitoridectomyreproductivelydiscourteouslyunsynchronizedappendicectomyinconsiderablyidealisticallyhydropneumaticorthopedicallydirectionalityhydrocortisonedisconsolatelyconsuetudinarycyproheptadinediscontentedlyindestructiblypolynucleotidehedonisticallyelectrodynamicidiosyncrasieshypercivilizedincandescentlyprepsychedelicdryopithecinesimmethodicallyrecrystallizedadrenergicallypolyacrylamideencyclopaediasencyclopedisms
...View all with 14 letters...
Phrases (111)
order mysidaceapolymeric amidedata encryptionemily dickinsondynamic balancedynamic speakermass deficiencyradio frequencyhenry cavendishanser cygnoides
...View all with 14 letters...
Words (124)
confidentialitydisrespectfullycondescendinglyaerodynamicallycorrespondinglydemographicallyinconsideratelyinterdependencyperpendicularlyreproducibilitybidirectionallysemidocumentarythyroidectomiesdemystificationpsychedelicallyhydromechanicalpolysaccharidesdisenchantinglycyproheptadinessophisticatedlyradiometricallysemicylindricalpolynucleotidesdisconcertinglyoverconfidentlycoeducationallypolyacrylamidessuperintendencyreduplicativelysynecdochicallyaerodynamicistsdecarboxylationhypochondriasesdecarboxylatinghysterectomized
...View all with 15 letters...
Phrases (146)
auditory ossicledialysis machineadvisory servicefamily astacidaeturkey drumstickamebic dysenteryindependence dayorder alcyonariademocratic partyfamily cardiidae
...View all with 15 letters...
Words (50)
indiscriminatelyhemorrhoidectomyunpredictabilityindiscernibilitythyroidectomizedperpendicularitycyclophosphamidehydrocharidaceaehydrocharitaceaedecarboxylationsdodecaphonicallyoligodendrocyteschytridiomyceteshydroelectricityechocardiographyindescribabilityelectrohydraulicdemystificationscarboxypeptidasehendecasyllabicscardiomyopathiesimmunodeficiencyundemocraticallycryptobranchidaeancylostomatidaeencyclopedicallyhomoscedasticityepichlorohydrinsbrightly-colourednondeductibilitynondestructivelydiacetylmorphinehydrophilicitieshydrophobicitiessympathectomized
...View all with 16 letters...
Phrases (159)
hypodermic needlefamily cyprinidaecardiac glycosidefamily locustidaefamily buccinidaeaerodynamic forcefamily formicidaeglyceric aldehydefamily carangidaefamily castoridae
...View all with 16 letters...
Words (38)
superconductivityparathyroidectomycardiorespiratorythermodynamicallyinterdisciplinaryself-contradictorycercidiphyllaceaethermoperiodicitykaleidoscopicallyhypophysectomisedhypophysectomizeddisrespectabilitycyclophosphamidesdehydrochlorinasesamoyedic-speakingdehydrochlorinateptilonorhynchidaeindestructibilityaerothermodynamicturbidimetricallydesynchronisationdesynchronizationcarboxypeptidasesdeoxyribonucleasemicrodensitometrythermohydrometricornithorhynchidaephotoperiodicallyirreproducibilitydeterministicallyuncomprehendinglyepidemiologicallyhydroelectricallydialectologicallydihydroxyacetones
...View all with 17 letters...
Phrases (173)
cylinder separatorfamily trochilidaecaesarian deliveryfamily droseraceaedisorderly conducthexadecimal systemafrican yellowwoodfamily erinaceidaeindependent agencyfamily bucerotidae
...View all with 17 letters...
Words (18)
polyribonucleotidecylindrical-stemmedlipopolysaccharidemucopolysaccharidedehydrochlorinasesdehydrochlorinateddehydrochlorinatesneuroendocrinologyaerothermodynamicsdeoxyribonucleaseshydroxychloroquinehomobasidiomycetescholecystectomizedhydroelectricitieshydrometallurgicalsedimentologicallydiethylcarbamazinecoccidioidomycosesPhrases (163)
bombycilla cedrorunfreudian psychologypodilymbus podicepsread-only memory chipkilocycle per secondfamily trichechidaefamily desmidiaceaesolid body substancevictory in europe daygene delivery vector
...View all with 18 letters...
Words (21)
hydrochlorothiazidepolyribonucleotidesparathyroidectomiesmucopolysaccharideslipopolysaccharidescytodifferentiationmagnetohydrodynamicphenylthiocarbamidedehydrochlorinatingdehydrochlorinationphosphatidylcholinemercury-contaminatedcontradistinctivelydeoxyribonucleotideencephalomyelitideshydroxytetracyclinehydrometeorologicaldihydrostreptomycindiethylcarbamazineshypoadrenocorticismelectrocardiographyPhrases (172)
acetylsalicylic acidfamily cyclopteridaefamily cynoglossidaehydrastis canadensisfamily dasyproctidaenancy freeman mitfordfamily polypodiaceaehydrobates pelagicusdasypus novemcinctusliquid body substance
...View all with 19 letters...
Words (13)
tetrahydrocannabinolparathyroidectomizedhyperadrenocorticismcytodifferentiationsmagnetofluiddynamicsphenylthiocarbamidesdehydrochlorinationsphosphatidylcholinesmagnetohydrodynamicsdeoxyribonucleotidesencephalomyocarditishydrochlorothiazidesheterobasidiomycetesPhrases (154)
yellow-shafted flickerorder mycelia steriliaorder myxobacterialesfamily trachipteridaedivision tracheophytaclyde william tombaughfamily dermochelyidaesuricata tetradactylafamily pseudococcidaeclassifying adjective
...View all with 20 letters...
Words (2)
dendrochronologicallytetrahydrocannabinolsPhrases (92)
icelandic monetary unitelectrolytic condenserdesoxyribonucleic acideucalyptus fraxinoidescambodian monetary unitprocaine hydrochloridehenry hobson richardsonsamuel taylor coleridgefamily myrmecophagidaefederal security bureau
...View all with 21 letters...
Words (1)
encephalomyocarditisesPhrases (95)
trazodone hydrochloridefamily dendrocolaptidaesubfamily bassariscidaerhythm and blues musicianmale reproductive systembrachycome iberidifoliafamily branchiostomidaecombined dna index systemedna saint vincent millaynyctereutes procyonides
...View all with 22 letters...
Words (1)
electrocardiographicallyPhrases (59)
argyroxiphium sandwicensesubdivision deuteromycotamary wollstonecraft godwinunidentified flying objectprivately held corporationdistinguished flying crossapocynum androsaemifoliumantiarrhythmic medicationfluoxetine hydrocholoridetechnology administration
...View all with 24 letters...
Phrases (44)
francis scott key fitzgeraldmodest petrovich mussorgskypropoxyphene hydrochloridepolystichum acrostichoidesreligious society of friendscaulophyllum thalictroidesandrei arsenevich tarkovskylepidocybium flavobrunneumreticuloendothelial systemleboyer method of childbirth
...View all with 25 letters...
Phrases (39)
brassica oleracea gongylodeshunting and gathering societyhuman immunodeficiency viruscharles maurice de talleyrandrevolutionary calendar monthsubdivision coniferophytinasubdivision deuteromycotinabureau of diplomatic securityentandrophragma cylindricumconjunctival layer of eyelids
...View all with 26 letters...
Words (1)
ethylenediaminetetraacetatePhrases (27)
american revolutionary leaderholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkincommissioned military officertricyclic antidepressant drugtopical prostaglandin eyedropatrioventricular nodal rhythmhydraulic transmission systemdemeclocycline hydrochloride
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (21)
aleksandr feodorovich kerenskytriphosphopyridine nucleotideoxytetracycline hydrochloridefyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationmicrosoft disk operating systemfeodor mikhailovich dostoevskydepartment of homeland securitydissident irish republican army
...View all with 28 letters...
Phrases (17)
aleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemhydrangea macrophylla hortensisfrancisco jose de goya y lucientestheory of punctuated equilibriumarrhenius theory of dissociationfyodor mikhailovich dostoyevsky
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (15)
alexander isayevich solzhenitsyndepartment of energy intelligencedepository financial institutionethylenediaminetetraacetic acidwaterhouse-friderichsen syndromesevere acute respiratory syndromesevere combined immunodeficiencynontricyclic antidepressant drugdryopteris thelypteris pubescenstechnical analysis of stock trends
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (8)
digital communications technology2019-ncov acute respiratory diseaserecombinant deoxyribonucleic acidrichard august carl emil erlenmeyermarie anne charlotte corday d'armontfibrocystic disease of the pancreasdefense information systems agencymary godwin wollstonecraft shelleyPhrases (9)
nikolai andreyevich rimski-korsakovsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylatetheory of electrolytic dissociationyevgeni aleksandrovich yevtushenkotyrannus domenicensis domenicensisamaranthus hybridus erythrostachysacquired immune deficiency syndromePhrases (1)
enzyme-linked-immunosorbent serologic assay