Words Containing: C,A,S,K,Y,_
(In Any Order)
There are 170 words,
270 phrases and
0 abbr's with
C,A,S,K,Y,_ in.
Best Scoring Words With: C,A,S,K,Y,_
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
skyjack | 7 | 27 | verbv | |||||
verb • subject an aircraft to air piracy | ||||||||
kyacks | 6 | 19 | verb, nounv, n | |||||
Valid word for Scrabble US
| ||||||||
sickbay | 7 | 18 | noun, adjectiven, adj | |||||
noun • (nautical) a room for the treatment of the sick or injured (as on a ship) | ||||||||
skycaps | 7 | 18 | nounn | |||||
noun • a porter who helps passengers with their baggage at an airport | ||||||||
yapocks | 7 | 18 | nounn | |||||
Valid word for Scrabble US
| ||||||||
skycap | 6 | 17 | nounn | |||||
noun • a porter who helps passengers with their baggage at an airport | ||||||||
screaky | 7 | 16 | adjectiveadj | |||||
adjective satellite • having a rasping or grating sound • having or making a high-pitched sound such as that made by a mouse or a rusty hinge | ||||||||
slackly | 7 | 16 | adverb, adjectiveadv, adj | |||||
adverb • in a relaxed manner; not rigid | ||||||||
lackeys | 7 | 16 | nounn | |||||
noun • a male servant (especially a footman) • a person who tries to please someone in order to gain a personal advantage | ||||||||
yacks | 5 | 14 | verbv | |||||
noun • noisy talk verb • talk incessantly and tiresomely | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (36)
yardstickgunnysackstockyardpaychecksbackstoryskyjackedhaystackstrackwaysrockabyesdockyardslatchkeysblackboysplastickybackstayscryobanksskyjackerbackyardsclaybankseyeblacksswaybacksbuckayrosjackstaysrockawaysplaybacksgraybacksskiascopygreybacksscreakilyhickymalsskyscapesfishybackstackyardlockawaysdicky-seatrickyards
...View all with 9 letters...
Phrases (5)
gunny sackyeast caketipsy cakecandy kissstack awayWords (34)
skyscrapergraywackeskanamycinspiggybackscarrybacksjackasserybrickyardsyardsticksbuckyballsgunnysackspaddywacksjonnycakesskyjackersskyjackingswaybackedbackwoodsystockyardsfancyworkslackadaisychromakeysgreywackesstickybeaksooty-blackhackneyismpastrycookblackishlyfishybackshairybacksbrickclayscopytakersdickey-seatstackyardsrock-steadyrocksteadyPhrases (7)
pastry cooksafety lockplay trickskansas citylady's smockblack sallyprickly ashWords (22)
tchaikovskyskepticallyskyscrapersbricklayersskyjackingsbrainsicklytracklayersjohnnycakeshydrocrackschelyabinskspiny-backedstickybeakspaddywhackshackneyismspastrycooksyellowbacksyellowcakessynkaryonictracklesslywoollybackslobachevskykeratoscopyPhrases (11)
mackerel skynoam chomskyhockey skatemossy-cup oakmossycup oakvarsity sockrock crystalhans eysenckjack dempseycrystal mike
...View all with 11 letters...
Words (16)
bricklayingscytoskeletaltracklayingsstickybeakedblackish-grayblackish-greygreyish-blackalkalescencygrayish-blackkakistocracykaryoplasmicpancake-stylechimneystackcycloalkanesshockabilitystickabilityPhrases (14)
backspace keybuckeye statea. noam chomskystock companybackup systemhockey seasonswamp hickoryturk's cap-lilyshock therapyall-day sucker
...View all with 12 letters...
Words (10)
hydrocrackersstickybeakingfairnyticklesklyuchevskayacryoplanktonskenyapithecussketchabilitykeratomycosispsychometrikashockumentaryPhrases (14)
chesapeake bayvan wyck brooksrayon stockingtreasury stockst patrick's dayoyster crackergenus buckleyanootka cypresscoast boykiniasydney pollack
...View all with 13 letters...
Phrases (1)
technical analysis of stock trendsPhrases (1)
vladimir vladimirovich mayakovskiPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay