Words Containing: C,A,R,D,Y
(In Any Order)
There are 1,031 words,
1,675 phrases and
0 abbr's with
C,A,R,D,Y in.
Best Scoring Words With: C,A,R,D,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| dyarchy | 7 | 19 | nounn | |||||
noun • a form of government having two joint rulers | ||||||||
| keycard | 7 | 17 | nounn | |||||
noun • a plastic card that has a magnetically coded strip that is scanned in order to operate a mechanism | ||||||||
| diarchy | 7 | 16 | nounn | |||||
noun • a form of government having two joint rulers | ||||||||
| dryadic | 7 | 14 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| daycare | 7 | 13 | nounn | |||||
noun • childcare during the day while parents work | ||||||||
| ardency | 7 | 13 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| decayer | 7 | 13 | verb, nounv, n | |||||
Valid word for Scrabble US
| ||||||||
| acridly | 7 | 13 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| cedary | 6 | 12 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (42)
backyardcowardlydockyardcharladydormancyverdancycopyreadobduracycaryatidhyracoiddecenaryfederacycrayonedkeycardscoalyardendarchyradiancydaycarescheddarydecayerscarboyedsacredlydeaconrymordancyhydracidcustardydyarchicrancidlycitywardacriditycondylardinarchycowardrychelydradyschroa
...View all with 8 letters...
Phrases (6)
dry cleanhard copycd playerlady crabcandy bardairy cowWords (72)
democracysecondarycourtyardradicallyhydraulicjudiciarycordiallyayurvediccharybdisyardstickfiduciarypachydermchandleryscrapyardstockyardcomraderycomradelyranciditybrickyardchrysalidclepsydracrawdaddydecennarymydriatichyracoidseducatorydyscrasiacrabbedlydockyardsarchduchycoalyardsdyscrasicdyscraticpredacitycandygram
...View all with 9 letters...
Phrases (14)
ready cashcut-and-dryhue and crycandy corndry cerealcubic yardrice paddycrazy weedrock candyrapid city
...View all with 9 letters...
Words (113)
dictionaryhydraulicsschoolyardchardonnayincendiaryredundancydebaucherychurchyardcardiologymyocardiummyocardialcardplayerdegeneracycordialityjudicatorycopyreaderadvertencyclepsydrasacrylamideimmoderacyaccursedlybackwardlyayurvedicsbrickyardsyardstickspachydermsclepsydraecrazyweedsdyscrasiascandygramsacidimetryhydromancycybernatedcourtyardshydrospace
...View all with 10 letters...
Phrases (20)
canary birdsugar candycrown daisycarded yarnd'oyly cartedry cleanercathode raycanary seedvictory daybaby doctor
...View all with 10 letters...
Words (144)
documentaryaccordinglydrasticallydiscrepancypterodactylconfederacyaerodynamictachycardiapredictablyvaledictorycylindricalhydrocarboncrystalloidhydrocyanicpsychodramasecondarilybradycardiamyocarditistragicomedydeclaratorydeprecatorycardiopathybarefacedlypyramidicalveridicallycordwainerysyndicatorshydropathiccopyreadingdeterminacyirradicablyjuridicallydiscographycondolatoryacrylamides
...View all with 11 letters...
Phrases (40)
dry cleaningvictoria dayacrylic acidbald cypresslaundry cartboulder claygrand canyoncaraway seedmeadow clarygandy dancer
...View all with 11 letters...
Words (146)
dramaticallydisciplinaryconsiderablyperiodicallyaerodynamicscrystallizedhypochondriacarbohydratehyperaciditydiscordantlysporadicallyhydrographiccardiomegalyhydrodynamicconcordantlyinadvertencycommendatoryferricyanidehydrologicalidiosyncrasycrystalliseddepreciatoryabstractedlyhydrocephalycardiographydenunciatorycondemnatorybradycardiasachlorhydriadistractedlycadaverouslyintermediacyineradicablycotyledonaryaperiodicity
...View all with 12 letters...
Phrases (65)
christmas daydevil-may-caredramatic playsalivary ductacid hydrogenalkyl radicalgrand larcenycare deliverybreach of dutyrichard e. byrd
...View all with 12 letters...
Words (126)
contradictoryradioactivityhypochondriacparadoxicallydiscretionaryidiosyncratichydraulicallyhydrocephalusadrenalectomythermodynamicdiametricallyindescribablydisgracefullyhydrodynamicsrhapsodicallyindeterminacyconsideratelyhydrocephalicunpredictablydactylographycreditabilityradioactivelydiscreditablydictatoriallyprejudiciallyaerodynamicaldeprecatinglydeprecatorilyaperiodicallyclearheadedlyachlorhydriascoldheartedlyconstrainedlydigraphicallyhydromagnetic
...View all with 13 letters...
Phrases (66)
direct antonymadvocacy groupcardiac rhythmuranyl radicalcedar mahoganycanary islandsdata hierarchycretan dittanynook and crannybenzyl radical
...View all with 13 letters...
Words (135)
democraticallyundersecretarycardiomyopathythermodynamicsdiscriminatorypredictabilityinconsiderablyhydropneumaticendarterectomyorthopedicallydirectionalityconsuetudinarycyproheptadinepachydermatousdiscouraginglyparadisiacallyelectrodynamicrecommendatoryidiosyncrasiesconcentratedlyhydrocolloidalhydrodynamicalantidromicallyrecrystallizedadrenergicallypolyacrylamidehydrologicallydisciplinarilyhydrolyticallydisciplinarityhydromechanicsaerodynamicisthypochondriacsclairaudientlydecarboxylases
...View all with 14 letters...
Phrases (106)
lachrymal glandorder mysidaceapolymeric amidedata encryptiondynamic speakerbinary compoundradio frequencyhenry cavendishanser cygnoidesurinary indican
...View all with 14 letters...
Words (107)
aerodynamicallycardiopulmonarydramaturgicallyhypochondriacalgynandromorphicdemographicallyinconsideratelyperpendicularlybidirectionallysemidocumentaryhydromechanicalpolysaccharidescyproheptadineshydrobiologicalradiometricallysemicylindricalpolyacrylamidesreduplicativelycontradictorilyaerodynamicistsdecarboxylationhypochondriasesdecarboxylatingdithyrambicallyorthodonticallypharmacodynamicdermatoglyphicsglyceraldehydesineradicabilityideographicallythermodynamicalhydrostaticallyradiochemicallyelectrodialyseselectrodialysis
...View all with 15 letters...
Phrases (131)
auditory ossiclecharlotte cordayadvisory servicedasyprocta aguticomplex body parthydrocyanic acidamebic dysenterymacleaya cordataorder alcyonariagenus dasyprocta
...View all with 15 letters...
Words (37)
indiscriminatelyunpredictabilityrhabdomyosarcomadiscriminatorilyparadigmaticallyjurisdictionallyradiographicallyperpendicularityhydrocharidaceaehydrocharitaceaedecarboxylationspharmacodynamicsechocardiographyindescribabilityelectrohydrauliccarboxypeptidasecardiomyopathiesundemocraticallycryptobranchidaepseudoparenchymahydrodynamicallynoncontradictoryhydrodynamiciststranscendentallydiacetylmorphinenondiscretionarydihydroxyacetonemicroradiographymelodramaticallythelypteridaceaediagrammaticallyquasiperiodicitylepidobotryaceaeunidirectionallythermodynamicist
...View all with 16 letters...
Phrases (133)
family cyprinidaecardiac glycosidepodocarpus familycock-and-bull storyschool dictionarygrand canyon stateright to candidacyaerodynamic forcefamily formicidaemonosyllabic word
...View all with 16 letters...
Words (37)
parathyroidectomycardiorespiratorythermodynamicallymultidisciplinaryinterdisciplinaryself-contradictoryradiobiologicallycercidiphyllaceaeradioisotopicallyhypochondriacallyidiosyncraticallydisrespectabilitytransdisciplinaryhydrofluorocarbondehydrochlorinasedehydrochlorinatephonocardiographyptilonorhynchidaeaerothermodynamicturbidimetricallydesynchronisationdesynchronizationcarboxypeptidasesdeoxyribonucleaseangiocardiographyrhabdomyosarcomasornithorhynchidaephotoperiodicallypseudoparenchymasdeterministicallyhydroelectricallydiaphragmaticallynondiscriminatoryeleutherodactylusdihydroxyacetones
...View all with 17 letters...
Phrases (145)
mary mcleod bethuneclass rhodophyceaeantipsychotic drugcylinder separatorcylindrical liningfamily trochilidaecaesarian deliverycapital of marylandfamily droseraceaesanitary condition
...View all with 17 letters...
Words (15)
electrodynamometercylindrical-stemmedlipopolysaccharidemucopolysaccharidedehydrochlorinasesdehydrochlorinateddehydrochlorinatesaerothermodynamicsdeoxyribonucleasespropagandisticallyrhabdomyosarcomatapseudoparenchymatahydrometallurgicalindiscriminatinglydiethylcarbamazinePhrases (143)
bombycilla cedrorunfreudian psychologyread-only memory chipfamily trichechidaemegacycle per secondvictory in europe dayphoenix dactyliferaeducation secretarynew world flycatchercarex pseudocyperus
...View all with 18 letters...
Words (18)
hydrochlorothiazideparathyroidectomiesmucopolysaccharideslipopolysaccharidescytodifferentiationmagnetohydrodynamicpharmacodynamicallyphenylthiocarbamidedehydrochlorinatingdehydrochlorinationmercury-contaminatedelectrodynamometerscontradistinctivelyhydroxytetracyclinehydrometeorologicaldiethylcarbamazineshypoadrenocorticismelectrocardiographyPhrases (151)
family cyclopteridaescandinavian countryhydrastis canadensisfamily dasyproctidaebond-trading activitynancy freeman mitfordcalycanthus floridushydrobates pelagicussubfamily perdicidaeviral delivery vector
...View all with 19 letters...
Words (11)
tetrahydrocannabinolparathyroidectomizedhyperadrenocorticismcytodifferentiationsphenylthiocarbamidesdehydrochlorinationsmagnetohydrodynamicsencephalomyocarditispseudoparenchymatoushydrochlorothiazidesheterobasidiomycetesPhrases (137)
yellow-shafted flickerorder mycelia steriliaorder myxobacterialesfamily trachipteridaedivision tracheophytafamily dermochelyidaedianthus caryophyllussuricata tetradactylaorder actinomycetalescross-florida waterway
...View all with 20 letters...
Words (4)
mucopolysaccharidosisphosphoglyceraldehydedendrochronologicallytetrahydrocannabinolsPhrases (98)
icelandic monetary unitdesoxyribonucleic acideucalyptus fraxinoidescambodian monetary unitprocaine hydrochloridehenry hobson richardsonsamuel taylor coleridgefamily myrmecophagidaefederal security bureaucape verde monetary unit
...View all with 21 letters...
Words (2)
phosphoglyceraldehydesencephalomyocarditisesPhrases (84)
trazodone hydrochloridefamily dendrocolaptidaesubfamily bassariscidaerhythm and blues musicianmale reproductive systembrachycome iberidifoliafamily branchiostomidaeamygdalus communis amaraparliamentary proceduredoctor of sacred theology
...View all with 22 letters...
Words (1)
hydrochlorofluorocarbonPhrases (69)
thryothorus ludovicianuscanyonlands national parkdorothy rothschild parkerrichard brinsley sheridansciadopitys verticillatatricyclic antidepressantmcguffey eclectic readerssearch and destroy missionamerican federalist partysir harry maclennan lauder
...View all with 23 letters...
Words (1)
electrocardiographicallyPhrases (52)
argyroxiphium sandwicensesubdivision deuteromycotasubphylum cephalochordatamary wollstonecraft godwinprivately held corporationapocynum androsaemifoliumantiarrhythmic medicationtechnology administrationfederal republic of germanysir charles leonard woolley
...View all with 24 letters...
Phrases (38)
embryonal rhabdomyosarcomaigor fyodorovich stravinskyfrancis scott key fitzgeraldpolystichum acrostichoidescaulophyllum thalictroidesandrei arsenevich tarkovskylepidocybium flavobrunneumreticuloendothelial systemmachine readable dictionarydiesel-hydraulic locomotive
...View all with 25 letters...
Phrases (34)
brassica oleracea gongylodeshunting and gathering societydorothy mary crowfoot hodgkinhuman immunodeficiency viruscharles maurice de talleyrandrevolutionary calendar monthsubdivision coniferophytinasubdivision deuteromycotinabureau of diplomatic securityentandrophragma cylindricum
...View all with 26 letters...
Words (1)
ethylenediaminetetraacetatePhrases (29)
american revolutionary leaderholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinorder of our lady of mount carmelcommissioned military officersecretary of commerce and labortricyclic antidepressant drugtopical prostaglandin eyedropatrioventricular nodal rhythm
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (19)
aleksandr feodorovich kerenskyoxytetracycline hydrochloridefyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationmicrosoft disk operating systemfeodor mikhailovich dostoevskydepartment of homeland securitydissident irish republican armysodium carboxymethyl cellulose
...View all with 28 letters...
Phrases (16)
aleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemhydrangea macrophylla hortensisfrancisco jose de goya y lucientestheory of punctuated equilibriumarrhenius theory of dissociationfyodor mikhailovich dostoyevsky
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (10)
alexander isayevich solzhenitsyndepartment of energy intelligencedepository financial institutionethylenediaminetetraacetic acidwaterhouse-friderichsen syndromesevere acute respiratory syndromemucocutaneous lymph node syndromenontricyclic antidepressant drugtechnical analysis of stock trendsdame agatha mary clarissa christieWords (1)
dichlorodiphenyltrichloroethanePhrases (8)
2019-ncov acute respiratory diseaserecombinant deoxyribonucleic acidrichard august carl emil erlenmeyermarie anne charlotte corday d'armontfibrocystic disease of the pancreasvladimir vladimirovich mayakovskidefense information systems agencymary godwin wollstonecraft shelleyPhrases (11)
nikolai andreyevich rimski-korsakovsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylatetheory of electrolytic dissociationoculopharyngeal muscular dystrophyyevgeni aleksandrovich yevtushenkotyrannus domenicensis domenicensisfederal emergency management agencyamaranthus hybridus erythrostachys
...View all with 32 letters...
Phrases (8)
severe combined immunodeficiency diseaseattention deficit hyperactivity disordergenerally accepted accounting principlessecretary of housing and urban developmentacademy of motion picture arts and scienceskarl friedrich hieronymus von munchhausendefense advanced research projects agencyunited states national library of medicinePhrases (1)
enzyme-linked-immunosorbent serologic assay
