Words Containing: C,A,L,K,I,N,S
(In Any Order)
There are 123 words,
363 phrases and
0 abbr's with
C,A,L,K,I,N,S in.
Best Scoring Words With: C,A,L,K,I,N,S
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
blackfins | 9 | 20 | nounn | |||||
Valid word for Scrabble US
| ||||||||
cracklings | 10 | 19 | nounn | |||||
noun • the crisp residue left after lard has been rendered | ||||||||
shackling | 9 | 19 | verb, nounv, n | |||||
noun • a restraint that confines or restricts freedom (especially something used to tie down or restrain a prisoner) • a U-shaped bar; the open end can be passed through chain links and closed with a bar verb • bind the arms of • restrain with fetters | ||||||||
slingbacks | 10 | 19 | ||||||
noun • a shoe that has a strap that wraps around the heel | ||||||||
canvaslike | 10 | 19 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
slingback | 9 | 18 | nounn | |||||
noun • a shoe that has a strap that wraps around the heel | ||||||||
spackling | 9 | 18 | verb, nounv, n | |||||
noun • Something used to spackle; a material that fills cracks or holes. | ||||||||
blackings | 9 | 18 | nounn | |||||
noun • a substance used to produce a shiny protective surface on footwear | ||||||||
calfskins | 9 | 18 | nounn | |||||
noun • fine leather from the skin of a calf | ||||||||
slackening | 10 | 17 | verb, adjectivev, adj | |||||
noun • an occurrence of control or strength weakening | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
calkinsWords (34)
jacksonvillebackslappingstickhandledstickhandleslinebackingscandlesticksblacklistingbricklayingsspacewalkingshellackingsstickhandlerglucokinasesantibacklashantiblackismtracklayingswalkingstickracewalkingsflashbackingsk-ampicillingallsicknessranshacklingcramboclinksbackslidingsgoalkickingsbluejackingsforeslackingwarchalkingsquacksalvingcross-linkageblackwashingchalkinesseskitchenaliasworking-classhamshacklingPhrases (6)
chicken saladrankine scaleblack englishmilk cleanserjack nicklauswalking stickWords (21)
laughingstockswashbucklinganticlockwisekleptomaniacsblacksmithingcraftsmanlikestickhandlersstickhandlingwalkingsticksantiblackismsblackballingsfairniticklesfairnyticklesblackbirdingsconstablewickblackish-brownunscholarlikeneo-lamarckismblacklistingsbrownish-blackskepticalnessPhrases (17)
surgical knifekarl von frischsandlime brickcolubrid snakekitchen islandlipstick plantfishing tacklemashie niblickgenus hackeliacocker spaniel
...View all with 13 letters...
Words (10)
blacksmithingslaughingstocksmicroplanktonsgallsicknessesblackberryingsconstablewicksgaelic-speakingalkalescenciesdisacknowledgeclinopinakoidsPhrases (19)
charles dickensstanley kubricklake saint clairsnake-rail fencegenus brickeliaalaska king crabeucalyptus kinoluschka's tonsilartificial skinmichael jackson
...View all with 14 letters...
Words (7)
czechoslovakiankinestheticallycontraclockwiseunchristianlikeskepticalnessesdisacknowledgeddisacknowledgesPhrases (23)
capital of kansastragulus kanchilcommon blackfishsecurity blanketamerican kestrelmental quicknessfull service banklaughing jackasswilson's blackcapskew correlation
...View all with 15 letters...
Phrases (19)
nikolai vasilievich gogollewis and clark expeditioncanyonlands national parkyuri alekseyevich gagarinragnar anton kittil frischsir john douglas cockcroftbattle of the caudine forksislamic party of turkestanwernicke's encephalopathydual inline package switch
...View all with 23 letters...
Phrases (11)
richard buckminster fullercharles john huffam dickensmax karl ernst ludwig planckcounterclockwise rotationislamic group of uzbekistanblack and gold garden spiderwireless local area networklucy in the sky with diamondshuman t-cell leukemia virus-1charles franklin kettering
...View all with 24 letters...
Phrases (10)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanchannel islands national parklassen volcanic national parkemployee stock ownership planchristoph willibald von glucksir frederick gowland hopkinsneuromuscular blocking agentblack september organizationkathleen mansfield beauchampPhrases (17)
aleksandr sergeyevich pushkindirector-stockholder relationjerusalem artichoke sunflowerrodion romanovich raskolnikovaleksandr aleksandrovich bloknikolai ivanovich lobachevskyaleksandr porfirevich borodinx-linked recessive inheritancekazimir severinovich malevichuniversity of nebraska-lincoln
...View all with 27 letters...
Phrases (12)
aleksandr feodorovich kerenskystrategic arms limitation talkssergei mikhailovich eisensteincount lev nikolayevitch tolstoymikhail aleksandrovich bakuningates of the arctic national parkkonstantin sergeevich alekseevkaposi's varicelliform eruptioneast turkestan islamic movementeast turkistan islamic movement
...View all with 28 letters...
Phrases (1)
baron karl maria friedrich ernst von weber