Words Containing: C,A,K,E,Y
(In Any Order)
There are 170 words,
401 phrases and
0 abbr's with
C,A,K,E,Y in.
Best Scoring Words With: C,A,K,E,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
hackney | 7 | 19 | noun, adjectiven, adj | |||||
noun • a carriage for hire • a compact breed of harness horse | ||||||||
keycard | 7 | 17 | nounn | |||||
noun • a plastic card that has a magnetically coded strip that is scanned in order to operate a mechanism | ||||||||
screaky | 7 | 16 | adjectiveadj | |||||
adjective satellite • having a rasping or grating sound • having or making a high-pitched sound such as that made by a mouse or a rusty hinge | ||||||||
rackety | 7 | 16 | adjectiveadj | |||||
adjective satellite • uncontrollably noisy | ||||||||
lackeys | 7 | 16 | nounn | |||||
noun • a male servant (especially a footman) • a person who tries to please someone in order to gain a personal advantage | ||||||||
yacked | 6 | 16 | verbv | |||||
noun • noisy talk verb • talk incessantly and tiresomely | ||||||||
lackey | 6 | 15 | nounn | |||||
noun • a male servant (especially a footman) • a person who tries to please someone in order to gain a personal advantage | ||||||||
creaky | 6 | 15 | adjectiveadj | |||||
adjective satellite • worn and broken down by hard use • having a rasping or grating sound • of or pertaining to arthritis | ||||||||
tackey | 6 | 15 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
cakey | 5 | 14 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
cakeyWords (24)
thackerayhackneyedhackberrypaychecksskyjackedrockabyesgraywackelatchkeyslackeyingjonnycakeskyjackereyeblacksgreybacksscreakilyblack-greychromakeygreywackepinckneyagrey-blacklaybackedskyscapescandy-likecopytakerdicky-seatPhrases (8)
like crazyjockey cappay packetjack bennylayer cakehoney cakeyeast caketipsy cakeWords (32)
blackberryskyscraperbricklayereukaryoticgraywackesjackasserykerygmaticjonnycakeshackneyingjohnnycakeskyjackersswaybackedtracklayeryellowcakechromakeysgreywackescrakeberrystickybeakhackneyismhackneymanhackneymenpeacockerycreakinglyyellowbackcandymakercankeredlycopytakersdickey-seatrock-steadyakaryocytecrackberryrocksteadyPhrases (18)
johnny cakegrace kellysafety lockjan van eyckhockey gamehockey teamyankee corngrey jackaltally clerkrock beauty
...View all with 10 letters...
Words (29)
hypokalemicjabberwockyskepticallypiggybackedskyscrapersbricklayersgimcrackerypaddywackedunhackneyedfactoryliketracklayersjohnnycakeskineticallykleptocracychelyabinskspiny-backedstickybeakshackneyismsready-cookedcackleberrykeratectomyrheumatickyyellowbacksyellowcakestracklesslycycloalkenecycloalkanelobachevskykeratoscopyPhrases (21)
hockey coachpolicy makermackerel skyjourney cakehockey skatebicycle rackchicken yardparity checkkeep companynickel alloy
...View all with 11 letters...
Words (16)
karyokinetichydrocrackedcytoskeletalbackhandedlyhydrocrackerstickybeakedfairnyticklemockumentaryblackish-greygreyish-blackalkalescencyhydraulickedcrackerberrypancake-stylechimneystackcycloalkanesPhrases (26)
backspace keyhockey leaguebuckeye statehackney coachback of beyondyellow jacketpatrick henrydavy crockettdonkey jacketblack-eyed pea
...View all with 12 letters...
Words (17)
megakaryocytekinematicallyhydrocrackersstickybeakingblackberryingfairnyticklesclickety-clackblockheadedlyklyuchevskayaknickknackerykenyapithecussketchabilityprickly-leafedprickly-leavedkeratomycosispsychometrikashockumentaryPhrases (20)
factory workerrichard leakeyanxiety attackchesapeake bayblack mulberryready reckonertreasury stockoyster crackergenus buckleyacanyon live oak
...View all with 13 letters...
Words (9)
hyperkeratoticheterokaryoticcantankerouslymegakaryocyticacknowledgedlymegakaryocyteshydrokineticalblackberry-lilyblackberryingsPhrases (31)
emergency brakecapital of kenyablackberry bushdynamic speakerblack raspberrystanley kubrickrockrose familyblack-eyed susandesk dictionaryhydraulic brake
...View all with 14 letters...
Phrases (16)
dorothy rothschild parkeryuri alekseyevich gagarinauto-blocking belay devicebryce canyon national parkfriedrich august von hayekislamic party of turkestantheory of weak interactionwernicke's encephalopathywilliam bradford shockleynew york state canal system
...View all with 23 letters...
Phrases (11)
francis scott key fitzgeraldpyotr alexeyevich kropotkinandrei arsenevich tarkovskycygnus columbianus bewickiialeksey maksimovich peshkovmikhail yurievich lermontovchamaecyparis nootkatensischronic myelocytic leukemiacommunist party of kampucheawilliam makepeace thackeray
...View all with 25 letters...
Phrases (1)
technical analysis of stock trendsPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay