Words Containing: A,Y,R
(In Any Order)
There are 12,814 words,
8,356 phrases and
4 abbr's with
A,Y,R in.
Best Scoring Words With: A,Y,R
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| pharynx | 7 | 22 | nounn | |||||
noun • the passage to the stomach and lungs; in the front part of the neck below the chin and above the collarbone | ||||||||
| quavery | 7 | 22 | adjectiveadj | |||||
adjective • Apt to quaver; shaky, trembling. | ||||||||
| exarchy | 7 | 22 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| crazily | 7 | 21 | adverbadv | |||||
adverb • in an insane manner | ||||||||
| coryzal | 7 | 21 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| coryzas | 7 | 21 | nounn | |||||
noun • an inflammation of the mucous membrane lining the nose (usually associated with nasal discharge) | ||||||||
| uncrazy | 7 | 21 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| jaybird | 7 | 20 | nounn | |||||
noun • common jay of eastern North America; bright blue with grey breast | ||||||||
| hyraxes | 7 | 20 | nounn | |||||
noun • any of several small ungulate mammals of Africa and Asia with rodent-like incisors and feet with hooflike toes | ||||||||
| hayfork | 7 | 20 | nounn | |||||
noun • a long-handled fork for turning or lifting hay | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (443)
reallylawyerhardlyfridaynearlyplayerbarelygrannytaylornearbyprayersalarybetrayharveyfairlyrarelybrandynorwayfreakydearlybarneyrunwaymurrayhooraybakerytreatypartlymartyrarterytyrantgreasysawyerpastryhurrayquarry
...View all with 6 letters...
Phrases (15)
red baybar flymary iipry barwar crypay foru. s. armybay rume layergym rat
...View all with 6 letters...
Words (750)
alreadyanymorerealityclearlyfactorygermanytherapylibraryfranklybatterylaundrytragedycrystalcharityprivacyprimaryjanuarygravitygalleryharmonyrailwaypyramidvarietyrapidlygreatlybradleyslaveryhungarybraverycavalryrunawaycharleyfreewayroyaltypayroll
...View all with 7 letters...
Phrases (41)
by heartheat rayred claypay dirtpay raterosy boaday carerun awayarmy hutlay over
...View all with 7 letters...
Words (1217)
probablybirthdayanywheremilitarysaturdayeverydaycarryingordinarynormallythursdayattorneymarryingstrategycontrarymajorityfebruarybackyardbetrayalsolitarybroadwaypharmacyrosemarypartyingmoralitycategorytreasurykeyboardcowardlyliterarydrivewayinfantrybrutallybrittanyunderwayboundary
...View all with 8 letters...
Phrases (135)
mary janebody partby naturesmall frydry cleanzane greyvery fastaltar boy880 yardsiron lady
...View all with 8 letters...
Words (1577)
yesterdaycertainlynecessarycarefullysecretaryauthorityliterallynaturallytemporarydemocracygenerallybodyguardpregnancygraduallylegendaryimaginaryregularlystrangelyvirtuallygraveyardsecondarycertaintymonasteryparalyzedcourtyardmachineryartilleryyggdrasilsanctuaryprivatelyhyderabadinfirmaryvoluntaryformalitygeography
...View all with 9 letters...
Phrases (221)
salary cutrate of payguard dutycary grantloya jirgaman fridaylike crazyprayer matprayer rugready cash
...View all with 9 letters...
Words (1701)
apparentlypersonallyoriginallyconspiracylaboratorystrawberryscreenplayhystericalelementaryplaygroundbabysitterrelativelydictionaryrepeatedlyseparatelybankruptcycreativityfraternitysolidaritymissionarypreferablypopularitypresumablyvocabularytrajectoryaccuratelyremarkablytragicallycommentaryironicallyhereditaryreasonablyhyperspacedehydratedpsychiatry
...View all with 10 letters...
Phrases (343)
mary leakeybrya ebenusprivate eyebrandy nosehoney eatermaxim gorkyrift valleygolf playeremery papercarya ovata
...View all with 10 letters...
Words (1681)
anniversarypersonalitypracticallynecessarilydocumentaryfortunatelyphotographyimportantlydesperatelyunnecessarypsychiatrictemporarilypreliminarypermanentlyimmortalityvoluntarilycomfortablyprobabilityaccordinglyuncertaintyobservatorydaydreamingdangerouslymomentarilycalligraphybeneficiaryrespiratoryreactionaryspirituallytranquilitybrilliantlyarchaeologysymmetricalinvoluntarybureaucracy
...View all with 11 letters...
Phrases (459)
humphry davygrass familyin a broad waybody of waterbody servantgenus styraxmary shelleybryonia albaroentgen rayhoney badger
...View all with 11 letters...
Words (1531)
particularlypsychiatristdeliberatelychristianityincreasinglycontemporarychemotherapyevolutionarydramaticallydisciplinarypenitentiaryconservatorysatisfactoryhypocriticalspiritualitychoreographystraightawayconsiderablymiraculouslyhistoricallyaggressivelyromanticallyanthropologyartificiallytranquillityformaldehydehystericallyhorizontallyparamilitarytransylvaniaperiodicallyintermediaryinflammatorytransparencyfiguratively
...View all with 12 letters...
Phrases (533)
chlorophyll amary magdalenmary mccarthystaying powerwilliam wylerrandom memorycalvary crossadmiral deweyread-only fileearnest money
...View all with 12 letters...
Words (1268)
unfortunatelyextraordinaryrevolutionaryapproximatelyunnecessarilytheoreticallytraditionallytyrannosaurusvulnerabilityautobiographycontradictoryappropriatelycomplimentaryparliamentaryinadvertentlyradioactivitychrysanthemumpsychotherapyrealisticallyprecautionarystrategicallypredominantlyhypochondriacimprobabilitycategoricallyphysiotherapyspectacularlyinvoluntarilyparadoxicallycomparativelycomplementaryirretrievablysarcasticallyalternativelysupplementary
...View all with 13 letters...
Phrases (611)
harvey cushingaleatory musicel iskandriyahfamily laridaevaginal arterydirect antonymauditory sensegilbert murraymyrobalan plumin a similar way
...View all with 13 letters...
Words (943)
professionallycinematographymetaphoricallywholeheartedlyunderstandablyelectronicallyuncontrollablydemocraticallyrespectabilitygeographicallyinterplanetaryundersecretarycardiomyopathypancreatectomyastrophysicistunsatisfactorythermodynamicsterritorialityelectrotherapyhyperventilatecongratulatoryproportionallyexcruciatinglyconservativelyparapsychologydiscriminatorypredictabilitycharacterologysupernaturallysatisfactorilyembarrassinglyexperimentallynarcosynthesisphotogrammetrygovernmentally
...View all with 14 letters...
Phrases (670)
pearl mae baileythoracic cavityanthony burgesslachrymal glandorder mysidaceafamily ardeidaemyrrhis odoratapituitary dwarftubal pregnancypituitary gland
...View all with 14 letters...
Words (709)
extraordinarilyinternationallypsychotherapistsynchronizationenvironmentallyinappropriatelyphysiotherapistheterosexualitychronologicallysynergisticallycrystallizationparentheticallyplenipotentiarymicroscopicallyaerodynamicallyproportionatelymaneuverabilitycardiopulmonarytherapeuticallysynchronisationinstrumentalityinvulnerabilitycontroversiallycytomegalovirusuncomplimentaryrecrystallizingencephalographypostoperativelyunparliamentaryproportionalitydramaturgicallypolyunsaturateddemonstrativelyinspirationallylogarithmically
...View all with 15 letters...
Phrases (735)
syringa vulgarisauditory ossicleby fits and startscentaurea cyanuscharlotte cordayalimentary pastemount nyiragongomrs. humphrey wardadvisory servicefamily arecaceae
...View all with 15 letters...
Words (301)
indiscriminatelypheochromocytomacatastrophicallytriphenylmethaneunpredictabilityhyperventilationjournalisticallynonrevolutionaryelectromyographycircumstantiallypharmaceuticallysphygmomanometererythroblastosisextemporaneouslythermostaticallysurrealisticallythrombocytopeniarhabdomyosarcomaphotographicallyunprofessionallyparapsychologistconversationallyneuropsychiatricdiscriminatorilyhypersalivationsparadigmaticallypornographicallyheterokontophytacolorimetricallyexterritorialityjurisdictionallyparaformaldehydethermometricallyantistrophicallyspondylarthritis
...View all with 16 letters...
Phrases (699)
tympanic membranein a beastly manneritalian greyhoundstrictly speakingfamily cyperaceaechristian huygensfamily cyprinidaecapital of hungarywilliam wycherleyin all probability
...View all with 16 letters...
Words (200)
straightforwardlybacteriologicallyanthropologicallyparathyroidectomymaterialisticallycardiorespiratoryelectrostaticallycontemporaneouslythermodynamicallyphilanthropicallypsychotherapeuticmultidisciplinaryprobabilisticallyinterdisciplinaryantirevolutionaryhyperreactivitiesself-contradictoryradiobiologicallyisoelectronicallyphysiotherapeuticcercidiphyllaceaepolymorphonuclearparaformaldehydesradioimmunoassaysradioisotopicallyhyperstimulationsparapsychologistsparasitologicallyspectroscopicallyhyperventilationsnonprofessionallymonochromaticallyrationalisticallysphygmomanometersthrombocytopenias
...View all with 17 letters...
Phrases (688)
dame margot fonteynmary leontyne pricedivision bryophytaczech monetary unitmary mcleod bethunecuban monetary unitinterstate highwaypearly everlastingclass rhodophyceaecoccygeal vertebra
...View all with 17 letters...
Words (100)
characteristicallydisproportionatelyhypercoagulabilitypsychopharmacologyhyperaldosteronisminterchangeabilityneuropsychologicalpolyesterificationhypersensitizationpolymorphonuclearselectrodynamometerspectroheliographypsychotherapeuticssphygmomanometrieshypoparathyroidismpentylenetetrazolsanthropocentricitycylindrical-stemmedlaryngopharyngitislipopolysaccharidelymphangiographieshyperbilirubinemiastereospecificallytransformationallycalymmatobacteriumstoichiometricallyautobiographicallypteridospermaphytadiethylmalonylurearecrystallizationsmucopolysaccharidehypercholesteremiasaccharomycetaceaemagnetostrictivelymyeloproliferative
...View all with 18 letters...
Phrases (674)
bombycilla cedrorunbombycilla garrulusrevolutionary groupadministrative bodyfamily physeteridaedame sybil thorndikeeriobotrya japonicalachrymal secretionfreudian psychologygenus styracosaurus
...View all with 18 letters...
Words (73)
hyperparathyroidismhydrochlorothiazidecinematographicallypolyesterificationshypersensitizationsextralinguisticallyotorhinolaryngologyextraterritorialityparathyroidectomieshypolipoproteinemiaparthenogeneticallyhypoparathyroidismscrosslinguisticallynonrelativisticallymucopolysaccharideslipopolysaccharidescytodifferentiationbacteriochlorophyllmagnetohydrodynamicpharmacodynamicallyphenylthiocarbamidechromatographicallyechoencephalographydehydrochlorinatingdehydrochlorinationmercury-contaminatedelectrodynamometersphosphoenolpyruvatechromoblastomycosisinterdepartmentallyelectromagneticallycontradistinctivelyelectromechanicallythird-dimensionalityinterferometrically
...View all with 19 letters...
Phrases (560)
water-plantain familyfamily cyclopteridaescandinavian countryseventeen-year locustitalian monetary unithydrastis canadensislatvian monetary unitclass polyplacophoraalpine type of glaciergiles lytton strachey
...View all with 19 letters...
Words (43)
counterrevolutionaryuncharacteristicallyhypercholesterolemiaoverenthusiasticallytetrahydrocannabinolradioimmunoassayableparathyroidectomizedcrystallographicallyhyperadrenocorticismcytodifferentiationslymphogranulomatoseslymphogranulomatosisbacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphoenolpyruvatesneurophysiologicallyneuropsychiatricallyhyperlipoproteinemiaphotoautotrophicallymagnetohydrodynamicsultramicroscopicallyelectrophysiologicalmicrocrystallinitiesroentgenographicallyencephalomyocarditischemotherapeuticallyphotophosphorylationpseudoparenchymatoushydrochlorothiazidespsychopharmacologiesmicrophotometrically
...View all with 20 letters...
Phrases (483)
honduran monetary unityellow-shafted flickerorder mycelia steriliamalawian monetary unitlebanese monetary unitorder myxobacterialesbalaenoptera physalusfamily trachipteridaeoryctolagus cuniculusmarchantia polymorpha
...View all with 20 letters...
Words (18)
psychopharmacologicalotorhinolaryngologiststereomicroscopicallymucopolysaccharidosisacetylcholinesterasesphosphoglyceraldehydeotorhinolaryngologieselectromyographicallydendrochronologicallyphotolithographicallypolyvinyl-formaldehydephotophosphorylationsintersubstitutabilityantiferromagneticallyhypercholesterolemiaspsychopharmacologistspsychotherapeuticallytetrahydrocannabinolsPhrases (348)
icelandic monetary unitnikolai rimsky-korsakovigor ivanovich sikorskyaleksandr solzhenitsynmalaysian monetary unithelichrysum bracteatumbulgarian monetary unitdesoxyribonucleic acidhungarian monetary unitsri lankan monetary unit
...View all with 21 letters...
Words (11)
pentamethylenetetrazolspectrophotometricallyelectroencephalographyphosphoglyceraldehydesotorhinolaryngologicalotorhinolaryngologistscarboxymethylcelluloseelectrophysiologicallyhexamethylenetetramineencephalomyocarditisesdihydroxyphenylalaninePhrases (268)
venezuelan monetary unithaliaeetus leucorhyphusredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynaccessory before the factfamily dendrocolaptidaemultiple mononeuropathyloyalist volunteer force
...View all with 22 letters...
Words (5)
hydrochlorofluorocarboncarboxymethylcellulosespolytetrafluoroethylenehexamethylenetetramineshypobetalipoproteinemiaPhrases (212)
family threskiornithidaegeorge macaulay trevelyanposterior pituitary glandyellowstone national parkkazakhstani monetary unitthryothorus ludovicianusparis-sorbonne universityeuropean recovery programkyrgyzstani monetary unitcanyonlands national park
...View all with 23 letters...
Words (5)
laryngotracheobronchitishyperbetalipoproteinemiaelectrocardiographicallymicroelectrophoreticallyschizosaccharomycetaceaePhrases (147)
carnegie mellon universitylouis seymour bazett leakeyargyroxiphium sandwicensesubdivision deuteromycotadivision heterokontophytasubphylum cephalochordatamary wollstonecraft godwinprivately held corporationprimary sex characteristicsir terence mervyn rattigan
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyuvulopalatopharyngoplastyPhrases (110)
embryonal rhabdomyosarcomamyroxylon balsamum pereiraeigor fyodorovich stravinskymary wollstonecraft shelleydiamond wedding anniversaryfrancis scott key fitzgeraldsymphoricarpos orbiculatuscentral intelligence agencypolystichum acrostichoidesmelanerpes erythrocephalus
...View all with 25 letters...
Phrases (84)
brassica oleracea gongylodeshunting and gathering societydorothy mary crowfoot hodgkinhuman immunodeficiency virussecretary of veterans affairssubmandibular salivary glandemployee stock ownership planevelyn arthur saint john waughassyrian neo-aramaic languagecharles maurice de talleyrand
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (67)
business environment analysisamerican revolutionary leadernikita sergeyevich khrushchevholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinorder of our lady of mount carmelaugustus welby northmore puginco-operative republic of guyanacommissioned military officer
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (52)
revolutionary people's strugglealeksandr feodorovich kerenskyephippiorhynchus senegalensisoxytetracycline hydrochloridemarcus junius brutus the youngerfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationmicrosoft disk operating systemfeodor mikhailovich dostoevsky
...View all with 28 letters...
Phrases (34)
business environmental analysisaleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitscrutin uninominal voting systemedward george earle bulwer-lyttoninternational olympic committee
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (28)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligencedepository financial institutionethylenediaminetetraacetic acidbalance of international payments
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (20)
great smoky mountains national parkfreedom from involuntary servitude2019-ncov acute respiratory diseasetupac amaru revolutionary movementrevolutionary proletarian nucleusdiego rodriguez de silva y velazquezport-access coronary bypass surgeryprimary subtractive color for lightrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyer
...View all with 31 letters...
Phrases (25)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory druguniversity of california at berkeley
...View all with 32 letters...
Phrases (16)
autonomous sensory meridian responselycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human serviceshighly active antiretroviral therapy
...View all with 33 letters...
Phrases (11)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesdryopithecus rudapithecus hungaricuserasable programmable read-only memoryeinstein's general theory of relativityeinstein's special theory of relativitygymnosporangium juniperi-virginianaecomputerized axial tomography scanner
...View all with 34 letters...
Phrases (11)
communications security establishmentrevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence serviceimmaculate conception of the virgin maryhereditary motor and sensory neuropathynational socialist german workers' partydepartment of defense laboratory systemfraxinus pennsylvanica subintegerrima
...View all with 35 letters...
Phrases (9)
jakob ludwig felix mendelssohn-bartholdysecretary of state for the home departmentangiotensin-converting enzyme inhibitorchurch of jesus christ of latter-day saintsjuan carlos victor maria de borbon y borbonfield-sequential color television systemtransportation security administrationsecretary of health education and welfaresocialist people's libyan arab jamahiriyaPhrases (14)
severe combined immunodeficiency diseasefirst epistle of paul the apostle to timothyuniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and scienceskarl friedrich hieronymus von munchhausen
...View all with 37 letters...
