Words Containing: A,Y,I,S,H
(In Any Order)
There are 2,049 words,
1,703 phrases and
0 abbr's with
A,Y,I,S,H in.
Best Scoring Words With: A,Y,I,S,H
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
zanyish | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
lazyish | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
fishway | 7 | 19 | nounn | |||||
noun • A structure built on or around dams or locks to facilitate the migration of fish. | ||||||||
shipway | 7 | 18 | nounn | |||||
noun • structure consisting of a sloping way down to the water from the place where ships are built or repaired • a canal large enough for seagoing vessels | ||||||||
shakily | 7 | 17 | adverb, adjectiveadv, adj | |||||
adverb • in an insecurely shaky manner • in a manner characterized by trembling or shaking | ||||||||
babyish | 7 | 17 | adjectiveadj | |||||
adjective satellite • characteristic of a baby | ||||||||
yeshiva | 7 | 16 | noun, adjectiven, adj | |||||
noun • an academy for the advanced study of Jewish texts (primarily the Talmud) | ||||||||
clayish | 7 | 15 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
apishly | 7 | 15 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
grayish | 7 | 14 | adjectiveadj | |||||
adjective satellite • of an achromatic color of any lightness intermediate between the extremes of white and black | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (68)
physicalhysteriachastityladyshipshipyardladyfishcrayfishasphyxialavishlyphysaliascythianshabbilydandyishgarishlyrakishlytoadyishyeshivahflashilyholidayshighwaysvarnishyhyalineshyaloidsaguishlyhayricksyeshivasoafishlyshaggilythisawayspinachyhryvniashypoxiasshipwayssyrphianhyalites
...View all with 8 letters...
Phrases (2)
will haysday shiftWords (139)
physicianhairstylehimalayasdaylightshairspraychrysalischarybdishesitancypsychicalforsythiasisypheandashinglydysphasiaslavishlydysphoriachrysalidmawkishlyhydrastisdiaphysisfaddishlyknavishlydysthymiaraffishlyvampishlyfairishlyphysicalswaggishlycattishlyhyracoidssyrphianskaffiyehshysteriasshammyinghawkishlylechayims
...View all with 9 letters...
Phrases (6)
hair stylesay hey kidhair spraywill h. hayseasy chairwhisk awayWords (202)
physicallyhystericalsympathizepsychiatryhydraulicsstealthilyscathinglysympathisefreakishlyasphyxiatestraightlydisharmonysmashinglysociopathymetaphysichypoplasiamysophiliadysarthriaepiphysealepiphysialcrashinglyhaemolysismyastheniahesitantlyhypostasisholidayersprankishlycheapishlygynarchiessympathiesqualmishlydysphoriashairstylesshrievaltyunchastity
...View all with 10 letters...
Phrases (17)
spanish flybasil thymewhite daisychinese yamchalcis flyrush familychild's playart historydaisy wheelshowy daisy
...View all with 10 letters...
Words (249)
psychiatrichospitalitysympathetictchaikovskymetaphysicsfashionablybaryshnikovhypospadiassynesthesiaasphyxiatedsympathizerhairstylistsphericallyphysicalitypsychicallyrhinoplastyhilariouslypsychedeliageophysicalbiophysicalhypogastricsycophantichypoplasticsympathiserphysiatristsympathisedmccarthyismsoothsayingmisanthropyravishinglysqueamishlyanaphylaxisnonphysicalprophylaxisdysrhythmia
...View all with 11 letters...
Phrases (32)
sensory hairanise hyssopwhiskey neatsylvia plathship's galleygladys smithrhus typhinatahoka daisyvariety showpansy orchid
...View all with 11 letters...
Words (304)
psychiatristchristianitystraightawayhistoricallymetaphysicalpsychopathichystericallyasphyxiationastrophysicsharmoniouslypraiseworthypsychosocialpsychoactivesuperhighwayexhaustivelydishonorablyhypogonadismstylographichypnotisablepolygraphistasphyxiatingsynaesthesiasympathisingestheticallyhesitatinglyautohypnosiswhimsicalitychivalrouslyphysicalnesslachrymosityholisticallyfarsightedlyhyperkinesiaphysicalistsmethylamines
...View all with 12 letters...
Phrases (34)
shaking palsyphantasy lifechristmas daymass hysteriabirthday suitphysical bodyship's companyasthenic typerhyming slanghasty pudding
...View all with 12 letters...
Words (273)
psychologicalhomosexualityphysiologicalpsychosomaticphysiotherapyastonishinglyunsympatheticaestheticallyantipsychoticstaphylococcisyntheticallysyphilizationlymphoblastichydrodynamicsrhapsodicallynightmarishlyadmonishinglyunfashionablyastrophysicaldishonourablyinexhaustiblyperishabilityhyaluronidaseholidaymakersphagocytosingprophylacticslymphadenitishypocalcemiasphysiographerpharisaicallypolycythemiasgeophysicallyinhospitalityhyperacuitiesnonhysterical
...View all with 13 letters...
Phrases (64)
harvey cushingel iskandriyahsphyrna tiburomexican hyssopthree kings' daymusical rhythmmyles standishaythya affinishenry steinwayfamily history
...View all with 13 letters...
Words (275)
psychoanalysisastrophysicistthermodynamicspsychoanalyticmetaphysicallyscholasticallynarcosynthesispsychodynamicshydrotherapistanesthesiologyhistoriographyunhesitatinglypraiseworthilystretchabilityaminophyllineshypermasculinehypermetropiasmetaphysiciansstochasticallypyrimethamineshedonisticallyhyperrealisticsycophantishlyhistrionicallypsychosomaticsunchivalrouslypseudepigraphydiphenylaminesspermatophytichumanisticallyplatyhelminthshyperesthesiasichthyophagousinharmoniouslyaphoristically
...View all with 14 letters...
Phrases (82)
myrrhis odoratabusman's holidaychinese parsleyhenry cavendishartillery shellbahasa malaysiaphysical changephysical entitychimney swallowsir henry morgan
...View all with 14 letters...
Words (218)
psychologicallypsychotherapistsynchronizationanaesthesiologyphysiologicallyphilosophicallyphysiotherapistheterosexualitysympathomimeticsynchronisationsympatheticallyeuphemisticallyneuropsychiatrypsychiatricallyimperishabilitykinestheticallyadenohypophysispsychedelicallyphysiographicalmethylxanthinespsychoanalyzingpolysaccharidesastrophysicistsdisenchantinglypsychohistoriansycophanticallydishearteninglyhyperaggressivehypersalivationpsychometriciandistinguishablycyproheptadineshyperstimulatedhyperstimulatessophisticatedly
...View all with 15 letters...
Phrases (121)
dialysis machinejohn quincy adamshyoscyamus nigerspiny-headed wormarachis hypogaeajemaah islamiyahshorthand typistmythical monsterlymphatic vesselchicory escarole
...View all with 15 letters...
Words (102)
enthusiasticallycatastrophicallypsychoanalyticalerythroblastosisthermostaticallypsychobiologicalparapsychologistneuropsychiatrichypersalivationsinextinguishablyantistrophicallyspondylarthritishypersexualitiesinexhaustibilitythermoplasticityhyperstimulatingparaphrasticallyhyperstimulationparapsychologiesparasympatheticshypervitaminoseshypocoristicallynonpsychiatristsnonpsychologicalthyrocalcitoninspathophysiologicmonotheisticallyhypopituitarismsarchiepiscopallyhypostatizationsstenographicallycrystallographicstereophonicallycyanoethylationscyclohexylamines
...View all with 16 letters...
Phrases (132)
christian huygenschemical analysisnevil shute norwaymechanical systemschool dictionarypharyngeal tonsilrheims-douay biblereligious holidaythysanuran insectsuper heavyweight
...View all with 16 letters...
Words (56)
straightforwardlypsychotherapeutichyperreactivitiesphysiotherapeutichyperstimulationsparapsychologistshyperventilationshypnotizabilitiesthrombocytopeniaspathophysiologieshyposensitizationencephalomyelitiscrystallographieslymphadenopathiescyclophosphamidesphenylethylaminestransthoracicallydehydrochlorinaseorthopsychiatriesorthopsychiatristtriphenylmethanesgynandromorphismsneuropsychiatriesneuropsychiatristunsympatheticallymetapsychologicalsuperheavyweightsdesynchronisationdesynchronizationanachronisticallydephosphorylatingdephosphorylationrhynchocephaliansparapsychologicalschizophrenically
...View all with 17 letters...
Phrases (151)
division bryophytasalvia leucophyllainterstate highwaysubphylum craniatatheological systemantipsychotic drugprimary censorshipcalycanthus familypetasites hybridustypha angustifolia
...View all with 17 letters...
Words (57)
characteristicallypsychopathologicalhyperaldosteronismsociopsychologicalneuropsychologicalhypersensitizationspectroheliographypsychotherapeuticssphygmomanometrieshypoparathyroidismpathophysiologicalhyposensitizationslaryngopharyngitislipopolysaccharidepostpsychoanalyticlymphangiographiesstoichiometricallypteridospermaphytadistinguishabilitymucopolysaccharidehypercholesteremiadehydrochlorinasesdehydrochlorinatesorthopsychiatristsoscillographicallyspectrographicallyaerothermodynamicsneuropsychiatristselectromyographiesdemythologizationshistocompatibilitydephosphorylationsrhinolaryngologisthistophysiologicalhomobasidiomycetes
...View all with 18 letters...
Phrases (161)
division anthophytafamily physeteridaedame sybil thorndikelachrymal secretionfreudian psychologyclass schizomycetesantipsychotic agentgenus chamaecytisusshort-term liabilityhypostasis of christ
...View all with 18 letters...
Words (33)
hyperparathyroidismpsychophysiologicalhypersensitizationsparathyroidectomieshypoparathyroidismsmucopolysaccharideslipopolysaccharidescytopathogenicitiesphenomenalisticallyphosphatidylcholinechromoblastomycosisthird-dimensionalityhysterosalpingogramthree-dimensionalityencephalomyelitideshistopathologicallyhistoriographicallyparasympathomimeticpsychopharmacologicdiethylcarbamazinesphytohemagglutininshyperconcentrationstetramethyldiarsinehypoadrenocorticismdimethylnitrosaminepsychotomimeticallyhyperemotionalitiesdimethyltryptamineshyperexcitabilitiesexhibitionisticallyhyperirritabilitiesschizosaccharomycespolychromatophiliasPhrases (159)
hydrastis canadensisgiles lytton stracheydivision schizophytagenus symphoricarposavogadro's hypothesiscalycanthus floriduschinese monetary unitbritish capacity unithydrobates pelagicusuniversity of chicago
...View all with 19 letters...
Words (30)
uncharacteristicallyhypercholesterolemiaoverenthusiasticallycrystallographicallyhyperadrenocorticismindistinguishabilitylymphogranulomatosisbacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesneurophysiologicallyneuropsychiatricallymagnetohydrodynamicshistoincompatibilityelectrophysiologicalencephalomyocarditisphotophosphorylationhydrochlorothiazidespsychopathologicallypsychopharmacologiespsychopharmacologisthypercoagulabilitiesdimethylnitrosaminesheterobasidiomycetesplethysmographicallyhyperparathyroidismsPhrases (140)
yellow-shafted flickerwyethia amplexicaulisdivision tracheophytabalance sheet analysisdianthus caryophyllusmechanically skillfulmilton snavely hersheyfriendly relationshipsouth american countryclaude achille debussy
...View all with 20 letters...
Words (11)
psychopharmacologicalotorhinolaryngologistmucopolysaccharidosisacetylcholinesterasesotorhinolaryngologiesphotophosphorylationshypercholesterolemiaspsychopharmacologistspsychophysiologicallypsychotherapeuticallytetrahydrocannabinolsPhrases (116)
igor ivanovich sikorskyaleksandr solzhenitsynhelichrysum bracteatumparty to the transactionstrawberry haemangiomaarctostaphylos uva-ursiptolemy ii philadelphushenry hobson richardsonagricultural chemistryhans holbein the younger
...View all with 21 letters...
Words (4)
spectrophotometricallyotorhinolaryngologistselectrophysiologicallyencephalomyocarditisesPhrases (101)
haliaeetus leucorhyphusaleksandr i. solzhenitsynsodium tripolyphosphaterhythm and blues musicianathyrium thelypteroidesfamily branchiostomidaeatmospheric electricitysphyrapicus varius ruberhenry engelhard steinwaychrysanthemum balsamita
...View all with 22 letters...
Words (1)
hexamethylenetetraminesPhrases (78)
family threskiornithidaekazakhstani monetary unitcalycanthus occidentalisthryothorus ludovicianusbangladeshi monetary unitdorothy rothschild parkersouth korean monetary unittyrosine kinase inhibitorrichard brinsley sheridangroup pteridospermaphyta
...View all with 23 letters...
Words (3)
laryngotracheobronchitisphosphatidylethanolamineschizosaccharomycetaceaePhrases (63)
argyroxiphium sandwicensedivision heterokontophytaprimary sex characteristicexistentialist philosophytechnology administrationhypersensitivity reactionsir charles leonard woolleychrysosplenium americanumoxidative phosphorylationelectroconvulsive therapy
...View all with 24 letters...
Words (1)
phosphatidylethanolaminesPhrases (49)
igor fyodorovich stravinskysymphoricarpos orbiculatuspolystichum acrostichoidesbeggar-my-neighbour strategycaulophyllum thalictroidessir arthur stanley eddingtonandrei arsenevich tarkovskysudden infant death syndromeanthony charles lynton blairtympanuchus pallidicinctus
...View all with 25 letters...
Phrases (38)
hunting and gathering societyhuman immunodeficiency virusemployee stock ownership planevelyn arthur saint john waughcharles maurice de talleyrandsubdivision coniferophytinanewton's theory of gravitationsystem of weights and measuresbenign prostatic hyperplasiapalestine national authority
...View all with 26 letters...
Phrases (35)
nikita sergeyevich khrushchevaleksandr sergeyevich pushkinaugustus welby northmore pugindeoxyadenosine monophosphatedeoxythymidine monophosphatethyrotropin-releasing hormonecryptobranchus alleganiensistaras grigoryevich shevchenkoprincipality of liechtensteinstationary stochastic process
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (25)
aleksandr feodorovich kerenskyephippiorhynchus senegalensismarcus junius brutus the youngerfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskyfeodor mikhailovich dostoevskydepartment of homeland securitydissident irish republican armycount lev nikolayevitch tolstoysodium carboxymethyl cellulose
...View all with 28 letters...
Phrases (14)
aleksandr nikolayevich scriabindisorganized type schizophreniasao thome e principe monetary unithydrangea macrophylla hortensispresident william henry harrisonarrhenius theory of dissociationfyodor mikhailovich dostoyevskysecondary sexual characteristicalfred habdank skarbek korzybskifeodor mikhailovich dostoyevsky
...View all with 29 letters...
Phrases (14)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library sciencewaterhouse-friderichsen syndromehenri rene albert guy de maupassanttechnical analysis of stock trendsfamily schizosaccharomycetaceaeprovisional irish republican armyparathelypteris novae-boracensis
...View all with 30 letters...
Phrases (14)
nikolai andreyevich rimski-korsakovhierarchical classification systemsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylateprimary subtractive colour for lighttheory of electrolytic dissociationyevgeni aleksandrovich yevtushenkoprogressive emphysematous necrosis
...View all with 32 letters...
Phrases (8)
right to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometersecretary of health and human servicespositron emission tomography scannersubacute inclusion body encephalitisamaranthus hybridus hypochondriacusphysiological jaundice of the newbornPhrases (1)
respiratory distress syndrome of the newborn