Words Containing: A,Y,I,L,G,_
(In Any Order)
There are 2,051 words,
1,419 phrases and
0 abbr's with
A,Y,I,L,G,_ in.
Best Scoring Words With: A,Y,I,L,G,_
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
gauzily | 7 | 20 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
glazily | 7 | 20 | ||||||
Valid word for Scrabble US
| ||||||||
lazying | 7 | 20 | verbv | |||||
Valid word for Scrabble US
| ||||||||
gawkily | 7 | 18 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
myalgic | 7 | 15 | adjectiveadj | |||||
adjective • of or relating to myalgia | ||||||||
yawling | 7 | 14 | verbv | |||||
noun • a ship's small boat (usually rowed by 4 or 6 oars) • a sailing vessel with two masts; a small mizzen is aft of the rudderpost verb • emit long loud cries | ||||||||
nylghai | 7 | 14 | noun, adjectiven, adj | |||||
noun • large Indian antelope; male is blue-grey with white markings; female is brownish with no horns | ||||||||
flaying | 7 | 14 | verbv | |||||
verb • strip the skin off | ||||||||
baggily | 7 | 14 | adverbadv | |||||
Valid word for Scrabble US
| ||||||||
playing | 7 | 13 | verb, adjectivev, adj | |||||
noun • the act of playing a musical instrument • the action of taking part in a game or sport or other recreation • the performance of a part or role in a drama | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
gailyWords (81)
almightydaylightapplyingrallyinglegalitydallyingplaygirlrelayingbelayingallayinggraylingtallyinglayeringungainlyachinglygarlickygarishlyravinglytangiblyyearlingdaringlycraggilygalabiyasplayingslangilyvagilityglassilyraginglysavinglymyalgiasgapinglymalignlyaguishlytaxinglyinlaying
...View all with 8 letters...
Phrases (1)
laying onWords (182)
yggdrasilillegallyamazinglyanalyzingmagicallylogicallydaylightsplaythinganalysingvulgarityradiologydigitallyoligarchyfragilityvaryinglyglaringlypygmalionsparinglygainfullyhaltinglyparleyingroaringlyaudiologyamusinglyfrugalityvainglorydashinglyglaciallyguayaquilhaughtilyadoringlygenialitylegionarywaylayinglanguidly
...View all with 9 letters...
Phrases (9)
loya jirgaegg layingivy leagueholy grailbilly goatparty girlfly agaricflying catlay figureWords (265)
originallytragicallyyugoslaviaobligatoryqualifyinggraciouslynegativelysurgicallyplaywrightlegitimacyscathinglycharminglyregularitycardiologyclarifyingdiagonallysingularlyfalsifyingannoyinglylaryngitisalarminglyillegalityprofligacystraightlyparalysingmenacinglypolygamistamplifyingmarginallymalignancysmashinglyhauntinglyoverlayingcatalyzinglaughingly
...View all with 10 letters...
Phrases (25)
dry wallinghanging flyivy leaguerlady godivaglycine maxglyptic artray of lightflying boatyagi aerialgrainy club
...View all with 10 letters...
Words (261)
geneticallyaccordinglycalligraphyoriginalitysingularityorganicallyyugoslavianappallinglyplaywritingangelicallygeophysicalgraphicallymalignantlyindignantlyclimatologyunceasinglyangioplastyirregularlyclassifyingunfailinglylithographybricklayingunsparinglyroleplayingdisarminglyharrowinglyravishinglyfilmographygenericallydeafeninglyscreaminglylegendarilystartlinglyagonizinglyflauntingly
...View all with 11 letters...
Phrases (39)
grass familylaying claimhigh qualitylaying wasteplaying areadry cleaningrunning playbilly grahamholding yardlegal injury
...View all with 11 letters...
Words (282)
increasinglyaggressivelymythologicalbiologicallyfigurativelylegitimatelyunimaginablycongenialityecologicallyungraciouslystaggeringlyirregularitybibliographyenchantinglymagneticallygeologicallydespairinglylogisticallyhygienicallyhypoglycemiaillegitimacylollygaggingstylographicetymologicalunwaveringlygratifyinglygratuitouslyastrobiologybullyraggingcardiomegalylallygagginghydroplaningcontagiouslyfatigabilitypolygraphist
...View all with 12 letters...
Phrases (58)
shaking palsypolicy changeginkgo familygravity faultbridge playerguitar playersolar gravitymanila magueyflaming poppyplaying field
...View all with 12 letters...
Words (286)
psychologicalsignificantlyphysiologicalgynaecologiststrategicallycategoricallymagnificentlyastonishinglyeverlastinglyideologicallypainstakinglyoveranalyzinggrammaticallyhypoglycaemicinfuriatinglyenergeticallygynecologicaldisparaginglyhumiliatinglymeaninglesslytypographicaldisgracefullygeometricallycrystallizingtheologicallymagisteriallyfascinatinglyunoriginalityoverbearinglynostalgicallydillydallyingmyoglobinuriapalynologicalnightmarishlyoutstandingly
...View all with 13 letters...
Phrases (72)
vaginal arterygilbert murraydwindling awaysalivary glandgenus dactylislillie langtrycatalog buyingliterary genrecrystal gazingphysical goods
...View all with 13 letters...
Words (230)
geographicallypathologicallyexcruciatinglygynaecologicalembarrassinglylinguisticallysociologicallyentertaininglybiographicallydiagnosticallyastrologicallyanesthesiologyetymologicallydisapprovinglyunhesitatinglyethnologicallymagniloquentlyillegitimatelyimpregnabilitygenerationallylightheartedlyinfrangibilitydiscouraginglyhypoallergenicinvigoratinglyupgradeabilitygenealogicallycryobiologicalegocentricallyintimidatinglyacceleratinglyunappetizinglygeopoliticallymisclassifyingantiregulatory
...View all with 14 letters...
Phrases (113)
pituitary glandprogram libraryrudyard kiplingmagnolia familyfagus sylvaticamilitary ratingmalpighian bodyphysical changegesneria familylibrary catalog
...View all with 14 letters...
Words (188)
psychologicallytechnologicallyanaesthesiologyphysiologicallychronologicallysynergisticallydisappointinglycytomegalovirusrecrystallizingdramaturgicallylogarithmicallygastronomicallyseismologicallydemographicallyheartbreakinglyinterrogativelyaccommodatinglyagranulocytosisunchangeabilitycommiseratinglyalgorithmicallyphysiographicalpsychoanalyzingmarriageabilitydisenchantinglydishearteninglynonbiologicallydistinguishablyhydrobiologicaluncopyrightableoverclassifyingsyllogisticallyhypervigilancesgravimetricallyuncomplainingly
...View all with 15 letters...
Phrases (112)
syringa vulgarisasamiya languagemail-order buyinggenus sylvilagusgenus bombycillafamily triglidaedoris may lessingegg-laying mammalmarginal utilityfamily mugilidae
...View all with 15 letters...
Words (86)
phylogeneticallyunapologeticallypsychobiologicalphotographicallyparapsychologistinextinguishablyparadigmaticallypornographicallyparamagneticallyradiographicallyotolaryngologisthyperstimulatingparapsychologieshyperventilatingphotolithographynonpsychologicalarchaeologicallypathophysiologichemoglobinopathycriminologicallyorganizationallyichthyologicallyiconographicallylyginopteridalesstenographicallycrystallographiclithographicallyflabbergastinglynonsignificantlyflexographicallystereoregularityindefatigabilitystrongyloidiasesstrongyloidiasislymphangiectasia
...View all with 16 letters...
Phrases (133)
italian greyhoundstrictly speakingcapital of hungarycardiac glycosidecommercial agencyalan lloyd hodgkindwight lyman moodycalystegia sepiumisland of guernseypharyngeal tonsil
...View all with 16 letters...
Words (60)
straightforwardlybacteriologicallyanthropologicallyradiobiologicallyunexchangeabilityparapsychologistsparasitologicallypathophysiologiesferrimagneticallymorphogeneticallylexicographicallycrystallographiesmicropaleontologylymphangiographiccytomegalovirusesconfigurationallypharmacologicallyimmunogeneticallyelectronegativityoceanographicallybibliographicallyzoogeographicallyglycosaminoglycantrigonometricallychromolithographyotolaryngologicalotolaryngologistsdisadvantageouslyelectromyographicmetapsychologicalmicrobiologicallydephosphorylatingpalaeoclimatologyparapsychologicalcryptographically
...View all with 17 letters...
Phrases (131)
hypoglycemic agentpearly everlastingmalaysian languagetheological systemcylindrical liningrepublic of hungarytypha angustifoliayeniseian languagefamily engraulidaegenus dactylorhiza
...View all with 17 letters...
Words (37)
hypercoagulabilitypsychopathologicalinterchangeabilitysociopsychologicalneuropsychologicalspectroheliographypathophysiologicallaryngopharyngitislymphangiographiesautobiographicallydistinguishabilitymagnetostrictivelyphenomenologicallyophthalmologicallygeochronologicallyglycosaminoglycansoscillographicallygranulocytopoiesesspectrographicallygranulocytopoiesiselectromyographiesultracentrifugallymetallographicallydemythologizationspropagandisticallyrhinolaryngologistroentgenologicallyhistophysiologicalhydrometallurgicalpsychobiographicalsedimentologicallyhydrometallurgistsphysiopathologicalindiscriminatinglypsychopathologists
...View all with 18 letters...
Phrases (141)
bombycilla garrulusrevolutionary groupfreudian psychologynavigational systemfamily asparagaceaefamily polygalaceaefulminating mercuryfamily magnoliaceaearthur garfield haysrepublic of paraguay
...View all with 18 letters...
Words (23)
psychophysiologicalcinematographicallyextralinguisticallyotorhinolaryngologyparthenogeneticallycrosslinguisticallychromatographicallydehydrochlorinatingelectromagneticallyhysterosalpingogramcross-linguisticallyelectroretinographycharacterologicallyhistopathologicallyhistoriographicallyhydrometeorologicalpsychopharmacologicsymptomatologicallyphytogeographicallyphytohemagglutininssociolinguisticallypaleogeographicallyelectrocardiographyPhrases (113)
family cynoglossidaealpine type of glaciergiles lytton stracheycapital of kyrgyzstansalicylate poisoninghydrobates pelagicussolidarity surchargefamily zingiberaceaegerard manley hopkinssantiago ramon y cajal
...View all with 19 letters...
Words (14)
crystallographicallyindistinguishabilitylymphogranulomatosismagnetofluiddynamicsoophorosalpingectomyneurophysiologicallyelectrophysiologicalroentgenographicallypsychopathologicallypsychopharmacologiespsychopharmacologistsyncategorematicallyhypercoagulabilitiesplethysmographicallyPhrases (92)
oryctolagus cuniculusclyde william tombaughbyelorussian languagemagnetic bubble memoryclassifying adjectiveluscinia megarhynchosfamily gasterosteidaemilitary intelligenceglycerol tripalmitatefamily gleicheniaceae
...View all with 20 letters...
Words (11)
psychopharmacologicalhypogammaglobulinemiaotorhinolaryngologistotorhinolaryngologieselectromyographicallydendrochronologicallyphotolithographicallyantiferromagneticallypsychopharmacologistspsychophysiologicallyclinicopathologicallyPhrases (83)
bulgarian monetary unitcynoglossum officinaleginglymostoma cirratumsamuel taylor coleridgeagricultural chemistryfamily myrmecophagidaehans holbein the youngerfamily grossulariaceaecongenital abnormalitymongolian monetary unit
...View all with 21 letters...
Words (3)
otorhinolaryngologicalotorhinolaryngologistselectrophysiologicallyPhrases (65)
guatemalan monetary unitamygdalus communis amarahenry engelhard steinwaysamuel pierpoint langleydisplaying incompetencenotemigonus crysoleucasedward kennedy ellingtonbahasa malaysia languagesubclass crossopterygiisir george otto trevelyan
...View all with 22 letters...
Words (2)
laryngotracheobronchitiselectrocardiographicallyPhrases (36)
carnegie mellon universitymary wollstonecraft godwintechnology administrationfederal republic of germanypaul johann ludwig von heyseposterior meningeal arteryconstitutional psychologyelectromagnetic delay linepityrogramma chrysophyllaprimary colour for pigments
...View all with 24 letters...
Phrases (17)
francis scott key fitzgeraldcentral intelligence agencysir arthur stanley eddingtonreticular activating systemarab revolutionary brigadescygnus columbianus bewickiimargaret munnerlyn mitchellmercury-in-glass thermometergeneral theory of relativitythyroid-stimulating hormone
...View all with 25 letters...
Phrases (20)
brassica oleracea gongylodessubmandibular salivary glandevelyn arthur saint john waughassyrian neo-aramaic languageentandrophragma cylindricumbenign prostatic hyperplasiamyrtillocactus geometrizansgilles de la tourette syndromecircumflex artery of the thighcalifornia single-leaf pinyon
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (21)
george percy aldridge graingeraleksandr sergeyevich pushkinaugustus welby northmore puginco-operative republic of guyananuclear regulatory commissiontricyclic antidepressant drugjames augustine aloysius joycethyrotropin-releasing hormonecryptobranchus alleganiensistopical prostaglandin eyedrop
...View all with 27 letters...
Phrases (13)
revolutionary people's struggleephippiorhynchus senegalensisrevolutionary communist leaguecygnus columbianus columbianusimperial japanese morning gloryhypothalamic releasing hormonecentral intelligence machinerymilitary intelligence section 5military intelligence section 6melanocyte-stimulating hormone
...View all with 28 letters...
Phrases (11)
great smoky mountains national parkdigital communications technologydiego rodriguez de silva y velazquezprimary subtractive color for lightrichard august carl emil erlenmeyerinternational atomic energy agencyinternational intelligence agencymarine corps intelligence activityovulation method of family planningnorth atlantic treaty organization
...View all with 31 letters...
Phrases (9)
pityrogramma calomelanos aureoflavaright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemhighly active antiretroviral therapyinternational law enforcement agencyunited states intelligence communityphysiological jaundice of the newbornPhrases (1)
enzyme-linked-immunosorbent serologic assay