Words Containing: A,Y,E,A
(In Any Order)
There are 2,809 words,
5,298 phrases and
0 abbr's with
A,Y,E,A in.
Best Scoring Words With: A,Y,E,A
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| quayage | 7 | 20 | nounn | |||||
noun • a fee charged for the use of a wharf or quay | ||||||||
| analyze | 7 | 19 | verbv | |||||
verb • consider in detail and subject to an analysis in order to discover essential features or meaning • make a mathematical, chemical, or grammatical analysis of; break down into components or essential features • break down into components or essential features • subject to psychoanalytic treatment | ||||||||
| kayaked | 7 | 19 | verbv | |||||
verb • To use a kayak, to travel or race in a kayak. • To traverse (a body of water) by kayak. | ||||||||
| kayaker | 7 | 18 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| headway | 7 | 17 | nounn | |||||
noun • vertical space available to allow easy passage under something • forward movement | ||||||||
| academy | 7 | 15 | nounn | |||||
noun • a secondary school (usually private) • an institution for the advancement of art or science or literature • a school for special training • a learned establishment for the advancement of knowledge | ||||||||
| raceway | 7 | 15 | noun, adjectiven, adj | |||||
noun • a canal for a current of water • a course over which races are run | ||||||||
| getaway | 7 | 14 | nounn | |||||
noun • the attribute of being capable of rapid acceleration • a rapid escape (as by criminals) | ||||||||
| gateway | 7 | 14 | noun, adjectiven, adj | |||||
noun • an entrance that can be closed by a gate | ||||||||
| payable | 7 | 14 | adjectiveadj | |||||
noun • a liability account showing how much is owed for goods and services purchased on credit adjective satellite • subject to or requiring payment especially as specified | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (59)
alreadyacademyanalyzegetawaygatewaydaycarehearsayanalysepayableheadwaydaresayarrayedcyanateyardageamylaseallayedracewayabeyantallayerkayakedkayakerlanewayareawaysayableassayedseawaysanalyteareallyhyaenasalcaydequayagedaymareassayerapyrasepyaemia
...View all with 7 letters...
Phrases (22)
heat rayzea mayspay ratebay leafhay baleeat awayday careebb awaydie awaytea tray
...View all with 7 letters...
Words (166)
betrayalanalyzedanyplacedaybreakdaydreamtaxpayeralleywayhideawaygiveawayplaymateparalyzeanalysedcausewaymalarkeytakeawaysavagelysavagerylamaseryanalyseranalyzerwaterwayparalyseabeyanceclearwayheadachyayurvedanaysayerwayfarercatalyzebayesianplayableadequacyhaymakerreadablyacrylate
...View all with 8 letters...
Phrases (44)
mary janefeast daywipe awayfade awaygray areacome awaygive awayfile awayeasy markhive away
...View all with 8 letters...
Words (257)
graveyardparalyzedhyderabadfairytalespeakeasyplanetaryadversaryparalysedlafayetteannoyancebreakawaycataplexypageantryjaywalkercatalepsyhydrangeaplaymakerlaterallypeasantrypaymastermanslayercatalyzerthackerayleastwaysaveragelysalesladylaryngealpeaceablyhypallageparalyzerjayhawkermycenaeancatalyzedtachypneaagreeably
...View all with 9 letters...
Phrases (61)
rate of paylake nyasaprayer matready cashalex haleyheavy sparpay packetall the waybay staterwhile away
...View all with 9 letters...
Words (304)
apparentlyseparatelyapocalypsemayonnaiseaccuratelyremarkablyreasonablypleasantlypassagewayadequatelyballplayerunbearablyinadequacyarchetypalyardmastermateriallyapothecarydaydreamerasphyxiateascendancysalicylatepleasantrypharyngealisocyanatealimentarycardplayerdefamatorylamentablyunplayableanalyzablechalybeateadenopathyunabatedlymeasurablymyasthenia
...View all with 10 letters...
Phrases (105)
mary leakeymoshe dayangenus khayabarter awayyard markerlead astraycase-by-casegray marketgray matterdaily bread
...View all with 10 letters...
Words (321)
anniversarydaydreamingreactionaryarchaeologybureaucracyassemblymanaerodynamicexplanatorypreparatoryunspeakablyerraticallymaterialityasphyxiatedretaliatoryangelicallysteadfastlypleasurablyelaboratelypythagoreanalternatelyunabashedlyirreparablycarriagewayhypokalemiaaerobicallyancestrallyhaematologyfragmentaryunashamedlyinescapablyoveranalyzeanecdotallyparaldehydehyperphagiaappreciably
...View all with 11 letters...
Phrases (166)
laying wasteplaying areaoryx gazellaplayoff gamefree-and-easydwindle awaymemorial dayrailway linepiano playerafrican grey
...View all with 11 letters...
Words (408)
accidentallypennsylvaniapassionatelymetaphysicaltransparencypatheticallyaerodynamicsmechanicallyasymmetricalaromatherapyacademicallyunilaterallyemphaticallyclairvoyanceinadequatelybreathalyzeroceanographycarbohydrateunreasonablyimmeasurablyartillerymantheatricallyradiotherapyattractivelyhyperkalemiabehaviorallythematicallymajesticallyhaberdasherymagneticallyunpleasantlyimmaculatelyecstaticallybreathalyserunseasonably
...View all with 12 letters...
Phrases (211)
mary magdalenbackspace keyadmiral deweysquirrel awayphantasy lifebarbary sheepmaterial bodyascension daylienal arteryanas clypeata
...View all with 12 letters...
Words (415)
extraordinaryapproximatelyfundamentallyappropriatelyparliamentaryrealisticallyprecautionarystrategicallycategoricallyspectacularlycomparativelyalternativelyoveranalyzingaestheticallyencyclopaediapsychoanalyzemarketabilitysensationallyextravagantlyaffirmativelytheatricalityarchaeopteryxhypercalcemiaadrenalectomyeducationallypalaeontologypolycarbonatetransparentlyqualitativelycyanobacteriadiametricallypennsylvanianacceptabilitymagisteriallyunimpeachably
...View all with 13 letters...
Phrases (305)
aleatory musicel iskandriyahfamily laridaevaginal arteryfamily picidaeyakut languagespiny anteaterbattle of pydnaprivate treatyadmiralty mile
...View all with 13 letters...
Words (306)
cinematographysystematicallymetaphoricallyaffectionatelyunderstandablydemocraticallymathematicallygeographicallyalphabeticallyinterplanetarypancreatectomycharacterologysupernaturallygynaecologicalembarrassinglymetaphysicallytelepathicallyencephalopathyappreciativelyidealisticallydepartmentallyarchetypicallyquantitativelypaleopathologybrachycephalicasymmetricallyempatheticallypachydermatousunalterabilityadvantageouslyinarticulatelyheavyheartedlygenerationallypleasurabilitygreatheartedly
...View all with 14 letters...
Phrases (402)
family apiaceaepearl mae baileybattle of nasebyanthony vandykeorder mysidaceawilliam tyndalefamily ardeidaetubal pregnancysabbatical yearnavy department
...View all with 14 letters...
Words (260)
extraordinarilyinternationallyinstantaneouslyinappropriatelyanaesthesiologylymphadenopathyparentheticallyaerodynamicallymaneuverabilitytherapeuticallycompassionatelyencephalographyunparliamentaryunacceptabilitypolyunsaturatedauthoritativelysympatheticallyarchitecturallydispassionatelydemographicallyheartbreakinglypalaeopathologytemperamentallysystematizationunchangeabilityunextraordinaryunadulteratedlymegagametophytehydromechanicalmerchantabilitycyanocobalaminemarriageabilitypolysaccharidesautotetraploidyelectroanalysis
...View all with 15 letters...
Phrases (526)
centaurea cyanuscharlotte cordayclass pelecypodaalimentary pasteasamiya languagedialysis machinefamily tinamidaefamily lemnaceaefamily arecaceaeby trial and error
...View all with 15 letters...
Words (128)
enthusiasticallypharmaceuticallyunapologeticallythermostaticallysurrealisticallyconversationallyhypersalivationshymenophyllaceaeparaformaldehydeextracorporeallyparamagneticallyadministrativelyparapsychologiesparasympatheticsapocryphalnessesmalayo-polynesianglossopharyngealarchaeoastronomyarchaeologicallyarchiepiscopallybureaucraticallyrechromatographystenographicallydenominationallyflabbergastinglyflexographicallyecclesiasticallycyanocobalaminescyanoethylationsperiphrasticallycaryophyllaceousindefatigabilityrelativisticallyhydrocharidaceaekinaesthetically
...View all with 16 letters...
Phrases (471)
tympanic membranein a beastly manneritalian greyhoundfamily cyperaceaefamily cyprinidaecardiac glycosidein an elaborate waychemical analysisamerican sycamorehypophyseal stalk
...View all with 16 letters...
Words (66)
bacteriologicallyparathyroidectomymaterialisticallycardiorespiratoryelectrostaticallythermodynamicallyantirevolutionarycercidiphyllaceaeunexchangeabilityparaformaldehydeskaleidoscopicallypaternalisticallymammothermographyarchitectonicallyferrimagneticallyunderstandabilitylexicographicallylaryngopharyngealcrystallographerscrystallographieslymphadenopathieshyperalimentationcounterfactualitymacroevolutionaryrecrystallizationoceanographicallybathythermographsonomatopoeticallyinteravailabilityelectroanalyticalacetylsalicylateszoogeographicallysamoyedic-speakingglossopharyngealsimperialistically
...View all with 17 letters...
Phrases (504)
dame margot fonteynsalvia leucophyllabalaena mysticetuscuban monetary unitinterstate highwaypearly everlastingclass rhodophyceaecoccygeal vertebrafamily dasypodidaelycopus americanus
...View all with 17 letters...
Words (35)
characteristicallyhypercoagulabilityinterchangeabilitylipopolysaccharidelymphangiographiescalymmatobacteriumpteridospermaphytadiethylmalonylurearecrystallizationsmucopolysaccharidesaccharomycetaceaepheochromocytomataspectrographicallyaerothermodynamicsrepresentationallyultracentrifugallymetallographicallyheavyheartednessesmethylnaphthalenespachycephalosaurusultrarevolutionarypalaeoanthropologycryptogrammataceaepseudoparenchymatahydrometallurgicalchlamydomonadaceaeintraventricularlydiethylcarbamazinehyperalimentationssemiquantitativelycorynebacteriaceaeunenthusiasticallyhypernationalistichyperpolarizationshyperrationalitiesPhrases (495)
administrative bodyfamily physeteridaeeriobotrya japonicalachrymal secretiongenus styracosaurusafghan monetary unitjohn orley allen tatenavigational systemmary wollstonecraftfamily trichechidae
...View all with 18 letters...
Words (30)
hyperparathyroidismcinematographicallyextralinguisticallyextraterritorialityparathyroidectomiesparthenogeneticallynonrelativisticallymucopolysaccharideslipopolysaccharidesconceptualisticallymagnetohydrodynamicphenomenalisticallyphenylthiocarbamideechoencephalographymercury-contaminatedinterdepartmentallyelectromagneticallyelectromechanicallyhysterosalpingogramanthropocentricallycharacterologicallyphenylpropanolamineparasympathomimeticdiethylcarbamazinesphytogeographicallycounterinflationarytetramethyldiarsinepaleogeographicallyschizosaccharomyceselectrocardiographyPhrases (429)
water-plantain familyacetylsalicylic acidfamily cyclopteridaefamily cynoglossidaeitalian monetary unithydrastis canadensislatvian monetary unitalpine type of glacierphytolacca americanafamily lepisosteidae
...View all with 19 letters...
Words (22)
uncharacteristicallyoverenthusiasticallytetrahydrocannabinolradioimmunoassayableparathyroidectomizedlymphogranulomatosesmagnetofluiddynamicsphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseneuropsychiatricallymagnetohydrodynamicsroentgenographicallyencephalomyocarditischemotherapeuticallypseudoparenchymatouspsychopharmacologiessyncategorematicallyhypercoagulabilitiesplethysmographicallyexistentialisticallyhyperparathyroidismsPhrases (393)
william stanley jevonshonduran monetary unitwyethia amplexicaulisorder mycelia steriliafamily phytolaccaceaemalawian monetary unitlebanese monetary unitorder myxobacterialesbalaenoptera physalusfamily trachipteridae
...View all with 20 letters...
Words (7)
hypogammaglobulinemiaalkylbenzenesulfonateacetylcholinesteraseselectromyographicallyantiferromagneticallypsychotherapeuticallytetrahydrocannabinolsPhrases (258)
icelandic monetary unitaleksandr solzhenitsynmalaysian monetary unithelichrysum bracteatumbulgarian monetary unithungarian monetary unitsri lankan monetary unitextrauterine pregnancybyzantine architecturetanzanian monetary unit
...View all with 21 letters...
Words (5)
pentamethylenetetrazolelectroencephalographyhexamethylenetetramineencephalomyocarditisesdihydroxyphenylalaninePhrases (216)
venezuelan monetary unithaliaeetus leucorhyphushydrated aluminium oxidealeksandr i. solzhenitsynaccessory before the factfamily dendrocolaptidaesubfamily bassariscidaeguatemalan monetary unitrhythm and blues musiciannicaraguan monetary unit
...View all with 22 letters...
Words (2)
hexamethylenetetramineshypobetalipoproteinemiaPhrases (157)
family threskiornithidaegeorge macaulay trevelyanposterior pituitary glandyellowstone national parkkazakhstani monetary unitcalycanthus occidentaliseuropean recovery programkyrgyzstani monetary unitbangladeshi monetary unitsouth korean monetary unit
...View all with 23 letters...
Words (5)
laryngotracheobronchitishyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolamineschizosaccharomycetaceaePhrases (114)
louis seymour bazett leakeyargyroxiphium sandwicensesubphylum cephalochordatamary wollstonecraft godwinprivately held corporationprimary sex characteristicsir terence mervyn rattiganbrassica oleracea botrytisalexandre emile jean yersinapocynum androsaemifolium
...View all with 24 letters...
Words (1)
phosphatidylethanolaminesPhrases (85)
embryonal rhabdomyosarcomamyroxylon balsamum pereiraemary wollstonecraft shelleydiamond wedding anniversaryfrancis scott key fitzgeraldcentral intelligence agencymelanerpes erythrocephalusbeggar-my-neighbour strategycaulophyllum thalictroidestrans-alaska pipeline system
...View all with 25 letters...
Phrases (66)
brassica oleracea gongylodeshunting and gathering societysecretary of veterans affairsevelyn arthur saint john waughassyrian neo-aramaic languagecharles maurice de talleyrandrevolutionary calendar monthnewton's theory of gravitationbureau of diplomatic securitysystem of weights and measures
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (51)
business environment analysisamerican revolutionary leadergeorge percy aldridge graingeraleksandr sergeyevich pushkinorder of our lady of mount carmelco-operative republic of guyananuclear regulatory commissiondeoxyadenosine monophosphatesecretary of commerce and labortricyclic antidepressant drug
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (33)
aleksandr feodorovich kerenskycardiopulmonary resuscitationdepartment of homeland securitymaster of arts in library sciencedissident irish republican armyrevolutionary communist leagueface-amount certificate companyrevolutionary proletarian armysmall computer system interfaceimperial japanese morning glory
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (30)
business environmental analysisaleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitedward george earle bulwer-lyttoninternational olympic committeemiddle east respiratory syndrome
...View all with 29 letters...
Phrases (24)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library sciencedepository financial institutionethylenediaminetetraacetic acidbalance of international paymentssevere acute respiratory syndromepolymonium caeruleum van-bruntiaecalymmatobacterium granulomatis
...View all with 30 letters...
Phrases (20)
great smoky mountains national parkdigital communications technology2019-ncov acute respiratory diseasetupac amaru revolutionary movementrevolutionary proletarian nucleusdiego rodriguez de silva y velazquezport-access coronary bypass surgeryprimary subtractive color for lightrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyer
...View all with 31 letters...
Phrases (20)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory druguniversity of california at berkeleyprimary subtractive colour for light
...View all with 32 letters...
Phrases (15)
autonomous sensory meridian responsepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human serviceshighly active antiretroviral therapyinternational law enforcement agency
...View all with 33 letters...
Phrases (12)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesdryopithecus rudapithecus hungaricusmassachusetts institute of technologyerasable programmable read-only memoryeinstein's general theory of relativityeinstein's special theory of relativitygymnosporangium juniperi-virginianae
...View all with 34 letters...
Phrases (11)
communications security establishmentrevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence serviceimmaculate conception of the virgin maryhereditary motor and sensory neuropathynational socialist german workers' partydepartment of defense laboratory systemfraxinus pennsylvanica subintegerrima
...View all with 35 letters...
Phrases (8)
jakob ludwig felix mendelssohn-bartholdysecretary of state for the home departmentchurch of jesus christ of latter-day saintsnational geospatial-intelligence agencyjuan carlos victor maria de borbon y borbontransportation security administrationsecretary of health education and welfaresocialist people's libyan arab jamahiriyaPhrases (13)
first epistle of paul the apostle to timothyuniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and scienceskarl friedrich hieronymus von munchhausendefense advanced research projects agency
...View all with 37 letters...
Phrases (1)
enzyme-linked-immunosorbent serologic assay
