Words Containing: A,Y,A,S
(In Any Order)
There are 2,749 words,
3,428 phrases and
0 abbr's with
A,Y,A,S in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
pyjamas | 7 | 21 | nounn | |||||
noun • a pair of loose trousers tied by a drawstring around the waist; worn by men and women in some Asian countries • (usually plural) loose-fitting nightclothes worn for sleeping or lounging; have a jacket top and trousers | ||||||||
yashmak | 7 | 19 | nounn | |||||
noun • the face veil worn by Muslim women | ||||||||
washday | 7 | 17 | nounn | |||||
noun • a day set aside for doing household laundry | ||||||||
yashmac | 7 | 17 | nounn | |||||
noun • the face veil worn by Muslim women | ||||||||
kayaks | 6 | 17 | nounn | |||||
noun • a small canoe consisting of a light frame made watertight with animal skins; used by Eskimos verb • travel in a small canoe | ||||||||
anyways | 7 | 16 | adverbadv | |||||
adverb • used to indicate that a statement explains or supports a previous statement | ||||||||
affrays | 7 | 16 | noun, adjectiven, adj | |||||
noun • noisy quarrel • a noisy fight | ||||||||
paydays | 7 | 16 | nounn | |||||
noun • the day on which you receive pay for your work | ||||||||
kabayas | 7 | 16 | ||||||
Valid word for Scrabble US
| ||||||||
maydays | 7 | 16 | nounn | |||||
noun • an internationally recognized distress signal via radiotelephone | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (102)
fantasyanywaysashtrayanalystpyjamashearsayanalysedaresayasamiyaabysmalassyriasaroyandaystarwashdayabyssalgainsayamylasenasallyskagwayyashmacyashmakdaysmannaysaidairwaysaffraysbasallysayableassayedyautiasseawayspaydayssabayonpayolasbabysatparlays
...View all with 7 letters...
Phrases (7)
zea maysfast daypay cashlast dayeasy layas we sayasa grayWords (228)
saturdaynowadaysanalysismalaysiacasualtycasuallystairwaysanitaryhaystacksayonaracatalyststowawaydisarrayanalysedcausewaycastawaysavagelysavageryasphyxialamaseryanalyserassyrianparalysestatuarymainstaysalutaryastrallysavoyardbioassayphysalianaysayersalivaryrascallysanatorysagacity
...View all with 8 letters...
Phrases (34)
shut awayswamp bayfeast daysign awayalms traysalt awaystow awayeasy markarmy basesoya bean
...View all with 8 letters...
Words (321)
basicallysanctuaryhimalayasspeakeasyparalysisadversaryparalysedcataclysmmalaysiananalysingdastardlyhairsprayamarylliscausalityupsadaisyrascalityyachtsmanayahuascacatalepsyabyssiniascallywagpeasantrypaymasterspatiallymanslayerjanissaryscrapyardleastwayssalesladyabysmallysaltatoryslantwaysdysphasiahamadryasslaphappy
...View all with 9 letters...
Phrases (46)
salary cutlake nyasaready cashyard grassheavy sparstash awaylammas daybay statermealy sagemamma's boy
...View all with 9 letters...
Words (334)
separatelyapocalypsemayonnaiseyugoslaviareasonablypleasantlystationarypassagewaypythagorasunsanitaryyardmasterabyssinianasphyxiateparalysingascendancyabstractlysalicylatepleasantryisocyanateparoxysmalaccusatoryhypoplasiainsanitaryinsatiablydysarthriamycoplasmasatyagrahaunshakablysatyriasismeasurablymagistracymyastheniapantywaistseasonallyfantasying
...View all with 10 letters...
Phrases (63)
moshe dayangenus khayaparis daisysugar candylead astraysugar daddycase-by-casesean o'caseysubway faretake it easy
...View all with 10 letters...
Words (298)
anniversarydrasticallyaristocracycataclysmicassemblymanfashionablylaparoscopyunspeakablyclassicallyhypospadiasyugoslavianasphyxiatedsteadfastlypleasurablyunabashedlytyrannosaurancestrallynasopharynxangioplastyunashamedlyinescapablypsychodramasartoriallyanalysationrapaciouslyimmunoassaysteeragewayantislaverymasticatorybreathalyseanaphylaxishyperplasiasagaciouslytreasonablycataclysmal
...View all with 11 letters...
Phrases (103)
grass familylaying wasteoryza sativafree-and-easyshy away fromdylan thomasvena cysticaall souls' daycaraway seeddisplay case
...View all with 11 letters...
Words (355)
occasionallypennsylvaniapassionatelysatisfactorystraightawaymetaphysicaltransylvaniaasphyxiationtransparencyaerodynamicsartisticallyhypothalamusasymmetricalconstabularyunreasonablyimmeasurablymasturbatoryunmistakablystanislavskysporadicallymajesticallyhaberdasheryunpleasantlysadisticallyecstaticallybreathalyserunseasonablyscandalouslysubmaxillarycalamitouslyunassailablyasymptomaticacousticallyasphyxiatingnauseatingly
...View all with 12 letters...
Phrases (149)
backspace keyvisual acuityscantily cladcalvary crossshaking palsysquirrel awayphantasy lifebarbary sheepchristmas dayascension day
...View all with 12 letters...
Words (345)
statisticallytyrannosauruspsychoanalystfantasticallysubstantiallyrealisticallystrategicallyspectacularlysarcasticallypainstakinglyaestheticallypsychoanalyzesensationallydisparaginglytransparentlypennsylvanianmagisteriallyfascinatinglyrhapsodicallynostalgicallycryptanalysisspasmodicallysyntacticallymagnanimouslygeostationaryembarrassedlysituationallypsychoanalysetantalisinglyunfashionablylymphosarcomaastrophysicaltransitionaryinsatiabilityimpassability
...View all with 13 letters...
Phrases (176)
aleatory musicel iskandriyahin a similar wayadvisory boardspiny anteatercygnus atratuscooley's anemiaacrylate resinfactor analysecanary islands
...View all with 13 letters...
Words (249)
psychoanalysissystematicallyunderstandablysustainabilityunsatisfactoryparapsychologypsychoanalyticsupernaturallysatisfactorilyembarrassinglymetaphysicallyscholasticallyastronomicallyidealisticallyaltruisticallydiagnosticallyastrologicallystaphylococcalasymmetricallypachydermatousadvantageouslycycloparaffinspleasurabilityaxisymmetricalpsychoanalysespsychoanalyzedpsychoanalyzesmoralisticallymetaphysicianscarbonylationsstochasticallyparadisiacallyassimilabilityallostericallysalvageability
...View all with 14 letters...
Phrases (238)
battle of nasebyorder mysidaceamyrrhis odoratasabbatical yearclass scyphozoaadmiralty brassmaxillary sinusbusman's holidaycarya laciniosacooley's anaemia
...View all with 14 letters...
Words (215)
instantaneouslyanaesthesiologycrystallizationcompassionatelylackadaisicallypolyunsaturatedinspirationallygastronomicallycrystallographysympatheticallydispassionatelyritualisticallypsychiatricallyultrasonographysystematizationagranulocytosissymptomaticallyphysiographicalpsychoanalyzingcyanocobalaminspolysaccharidessycophanticallyelectroanalysishypersalivationunassailabilityankylostomiasesankylostomiasispostapocalypticsaccharomycetessuperabundantlytrypanosomiasisintravascularlyunrealisticallyancylostomiasesancylostomiasis
...View all with 15 letters...
Phrases (273)
syringa vulgarisby fits and startscentaurea cyanusclass pelecypodaalimentary pasteasamiya languagedialysis machinewystan hugh audenjohn quincy adamsadmiralty island
...View all with 15 letters...
Words (105)
enthusiasticallycatastrophicallypsychoanalyticaljournalisticallycircumstantiallymonosyllabicallythermostaticallysurrealisticallyrhabdomyosarcomaparapsychologistconversationallyhypersalivationsantistrophicallyparaphrasticallyadministrativelyparapsychologiespolysynapticallyparasympatheticsapocryphalnessesmalayo-polynesianglossopharyngealarchaeoastronomymonosynapticallyarchiepiscopallyhypostatizationsiconoclasticallycrystallizationsunsubstantialitystenographicallycrystallographicinsubstantialityflabbergastinglypostsynapticallyecclesiasticallyastrophotography
...View all with 16 letters...
Phrases (267)
in a beastly mannercardiac glycosidechemical analysisamerican sycamorehypophyseal stalkpodocarpus familyfamily locustidaecarya illinoensiscarya illinoinsissubfamily bovinae
...View all with 16 letters...
Words (48)
straightforwardlymaterialisticallycardiorespiratoryelectrostaticallyprobabilisticallyparaformaldehydeskaleidoscopicallyradioimmunoassaysradioisotopicallyparapsychologistsparasitologicallyrationalisticallypaternalisticallyunderstandabilityidiosyncraticallycrystallographerscrystallographiesuntranslatabilitytranscriptionallylymphadenopathiestransdisciplinaryrecrystallizationbathythermographsnationalisticallytransplantabilitytransthoracicallyacetylsalicylatessamoyedic-speakingglossopharyngealsglycosaminoglycanimperialisticallydisadvantageouslyunsympatheticallyimprovisationallymetapsychological
...View all with 17 letters...
Phrases (288)
salvia leucophyllabalaena mysticetusinterstate highwaypearly everlastingclass rhodophyceaefamily dasypodidaelycopus americanussubphylum craniatagenus symphalangusmalaysian language
...View all with 17 letters...
Words (37)
characteristicallypsychopharmacologypsychopathologicalhypoparathyroidismpathophysiologicallaryngopharyngitislipopolysaccharidepostpsychoanalyticlymphangiographiestransformationallypteridospermaphytarecrystallizationsmucopolysaccharidesaccharomycetaceaeglycosaminoglycansoscillographicallyspectrographicallyaerothermodynamicsrepresentationallyheavyheartednessesmethylnaphthalenespachycephalosauruspropagandisticallyrhabdomyosarcomatapseudoparenchymatapsychoanalyticallypsychobiographicalphysiopathologicalhyperalimentationssemiquantitativelytachistoscopicallyunenthusiasticallyclaustrophobicallyhypernationalisticsomnambulistically
...View all with 18 letters...
Phrases (313)
bombycilla garrulusadministrative bodydivision anthophytafamily physeteridaelachrymal secretiongenus styracosaurusnavigational systemmary wollstonecraftfamily asparagaceaeantipsychotic agent
...View all with 18 letters...
Words (20)
hyperparathyroidismextralinguisticallyparathyroidectomieshypoparathyroidismsnonrelativisticallymucopolysaccharideslipopolysaccharidesconceptualisticallyindividualisticallyphenomenalisticallyhysterosalpingogramhistopathologicallyhistoriographicallyparasympathomimeticpsychopharmacologicsymptomatologicallydiethylcarbamazinestetramethyldiarsineschizosaccharomycespolychromatophiliasPhrases (279)
acetylsalicylic acidscandinavian countryfamily cynoglossidaehydrastis canadensisclass polyplacophorafamily lepisosteidaezairese monetary unitfamily dasyproctidaejacques yves cousteaucapital of kyrgyzstan
...View all with 19 letters...
Words (24)
uncharacteristicallyoverenthusiasticallyradioimmunoassayablecrystallographicallylymphogranulomatoseslymphogranulomatosismagnetofluiddynamicsphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseneuropsychiatricallymagnetohydrodynamicsultramicroscopicallyencephalomyocarditispseudoparenchymatouspsychopathologicallypsychopharmacologiespsychopharmacologistsyncategorematicallyhypercoagulabilitiespalatopharyngoplastyplethysmographicallyexistentialisticallyhyperparathyroidismsPhrases (262)
william stanley jevonswyethia amplexicaulisorder mycelia sterilialebanese monetary unitorder myxobacterialesbalaenoptera physalusdivision tracheophytabalance sheet analysisbyelorussian languagedianthus caryophyllus
...View all with 20 letters...
Words (7)
psychopharmacologicalmucopolysaccharidosisalkylbenzenesulfonateacetylcholinesterasespsychopharmacologistspsychotherapeuticallytetrahydrocannabinolsPhrases (184)
nikolai rimsky-korsakovaleksandr solzhenitsynmalaysian monetary unithelichrysum bracteatumsri lankan monetary uniteucalyptus fraxinoidesisle royal national parkcapital of pennsylvaniaginglymostoma cirratumparty to the transaction
...View all with 21 letters...
Words (1)
encephalomyocarditisesPhrases (154)
haliaeetus leucorhyphusaleksandr i. solzhenitsynaccessory before the factsubfamily bassariscidaerhythm and blues musiciansurinamese monetary unitfamily branchiostomidaesphyrapicus varius ruberindonesian monetary unitedna saint vincent millay
...View all with 22 letters...
Words (1)
hexamethylenetetraminesPhrases (127)
family threskiornithidaeposterior pituitary glandyellowstone national parkkazakhstani monetary unitcalycanthus occidentaliskyrgyzstani monetary unitcanyonlands national parkbangladeshi monetary unitsouth korean monetary unittajikistani monetary unit
...View all with 23 letters...
Words (3)
laryngotracheobronchitisphosphatidylethanolamineschizosaccharomycetaceaePhrases (95)
louis seymour bazett leakeyargyroxiphium sandwicensesubphylum cephalochordatamary wollstonecraft godwinprimary sex characteristicsir terence mervyn rattiganbrassica oleracea botrytisalexandre emile jean yersinapocynum androsaemifoliumalfred edward woodley mason
...View all with 24 letters...
Words (2)
phosphatidylethanolaminesuvulopalatopharyngoplastyPhrases (76)
embryonal rhabdomyosarcomamyroxylon balsamum pereiraemary wollstonecraft shelleydiamond wedding anniversaryfrancis scott key fitzgeraldsymphoricarpos orbiculatusmelanerpes erythrocephalusbeggar-my-neighbour strategycaulophyllum thalictroidestrans-alaska pipeline system
...View all with 25 letters...
Phrases (60)
brassica oleracea gongylodeshunting and gathering societysecretary of veterans affairssubmandibular salivary glandevelyn arthur saint john waughassyrian neo-aramaic languagecharles maurice de talleyrandsubdivision basidiomycotinanewton's theory of gravitationsubdivision mastigomycotina
...View all with 26 letters...
Phrases (43)
business environment analysisaleksandr sergeyevich pushkinnuclear regulatory commissiondeoxyadenosine monophosphatesecretary of commerce and labortricyclic antidepressant drugjames augustine aloysius joycecryptobranchus alleganiensistaras grigoryevich shevchenkostationary stochastic process
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (29)
aleksandr feodorovich kerenskycardiopulmonary resuscitationdepartment of homeland securitymaster of arts in library sciencedissident irish republican armyrevolutionary communist leaguesmall computer system interfacecygnus columbianus columbianusimperial japanese morning glorypalestinian national authority
...View all with 28 letters...
Phrases (22)
business environmental analysisaleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitmiddle east respiratory syndromehydrangea macrophylla hortensispresident william henry harrison
...View all with 29 letters...
Phrases (22)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library sciencedepository financial institutionbalance of international paymentssevere acute respiratory syndromecalymmatobacterium granulomatiscalifornia personality inventorynontricyclic antidepressant drug
...View all with 30 letters...
Phrases (14)
great smoky mountains national parkdigital communications technology2019-ncov acute respiratory diseaserevolutionary proletarian nucleusdiego rodriguez de silva y velazquezport-access coronary bypass surgeryprimary subtractive color for lightrichard august carl emil erlenmeyerfibrocystic disease of the pancreasmarine corps intelligence activity
...View all with 31 letters...
Phrases (18)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory druguniversity of california at berkeleyprimary subtractive colour for light
...View all with 32 letters...
Phrases (12)
autonomous sensory meridian responsepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human servicespositron emission tomography scannersubacute inclusion body encephalitis
...View all with 33 letters...
Phrases (12)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesdryopithecus rudapithecus hungaricusmassachusetts institute of technologyerasable programmable read-only memoryeinstein's general theory of relativityeinstein's special theory of relativitygymnosporangium juniperi-virginianae
...View all with 34 letters...
Phrases (9)
communications security establishmentrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence servicehereditary motor and sensory neuropathynational socialist german workers' partydepartment of defense laboratory systemfraxinus pennsylvanica subintegerrimaunited states naval research laboratoryPhrases (8)
jakob ludwig felix mendelssohn-bartholdysecretary of state for the home departmentchurch of jesus christ of latter-day saintsnational geospatial-intelligence agencyjuan carlos victor maria de borbon y borbontransportation security administrationsecretary of health education and welfaresocialist people's libyan arab jamahiriyaPhrases (14)
first epistle of paul the apostle to timothyal-jama'a al-islamiyyah al-muqatilah bi-libyauniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and scienceskarl friedrich hieronymus von munchhausen
...View all with 37 letters...
Phrases (1)
enzyme-linked-immunosorbent serologic assay