Words Containing: A,T,E,Y,S
(In Any Order)
There are 3,302 words,
3,308 phrases and
0 abbr's with
A,T,E,Y,S in.
Best Scoring Words With: A,T,E,Y,S
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| jetways | 7 | 20 | nounn | |||||
noun • An elevated corridor connecting an airport to a plane, usually enclosed and used for disembarking and embarking passengers and crew. | ||||||||
| majesty | 7 | 19 | nounn | |||||
noun • impressiveness in scale or proportion | ||||||||
| streaky | 7 | 14 | adjectiveadj | |||||
adjective satellite • marked with or as if with stripes or linear discolorations | ||||||||
| astheny | 7 | 13 | nounn | |||||
noun • an abnormal loss of strength | ||||||||
| tawneys | 7 | 13 | nounn | |||||
noun • English economist remembered for his studies of the development of capitalism (1880-1962) | ||||||||
| wastery | 7 | 13 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| shantey | 7 | 13 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| safety | 6 | 12 | nounn | |||||
noun • the state of being certain that adverse effects will not be caused by some agent under defined conditions • a safe place • a device designed to prevent injury or accidents • (baseball) the successful act of striking a baseball in such a way that the batter reaches base safely • contraceptive device consisting of a sheath of thin rubber or latex that is worn over the penis during intercourse • a score in American football; a player is tackled behind his own goal line | ||||||||
| ecstasy | 7 | 12 | nounn | |||||
noun • a state of being carried away by overwhelming emotion • a state of elated bliss • street names for methylenedioxymethamphetamine | ||||||||
| sweaty | 6 | 12 | adjectiveadj | |||||
noun • One who is sweaty. • (sometimes humorous) A term of familiar address. adjective • Covered in sweat. • Having a tendency to sweat. • Likely to cause one to sweat. • Caused by sweat. • Strenuous; laborious; exhausting. • Inappropriately serious about a leisure activity, chiefly video games. | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (58)
majestytuesdaystanleyecstasyamnestystarkeymasterybeastlystatelyestuarystreakysectarysatietyasthenybarytesstrayerstayersstrayedyeastedbetraysjetwaysgyrateslysatesyattersestraysstalelystreamygaseitytawneystestacywasteryshanteyeustacyeustasyacetyls
...View all with 7 letters...
Phrases (5)
tea cosyw. b. yeatscat's eyefast dyerest dayWords (143)
strategytreasuryhysteriasteadilystracheyancestrytravestytapestryunsteadystealthyoverstayeasterlysteinwayamethystheavysetasystolemasterlythessalyforestaytypecastchastelysybariteessayistsedatelyasperityastutelyabsentlyloyalestexabytesscyphatestrayersanalytesyachtersgetawaysyeasting
...View all with 8 letters...
Phrases (10)
feast dayvery faststay overseed traysegway htp.a. systempa systembay statesweet baygo steadyWords (273)
yesterdaysecretaryspecialtystrangelymonasterysexualityhairstylesyndicateadversitypantyhosebystandervasectomyearnestlyausterityseaworthycatalepsypeasantrypaymasterhesitancysedentaryeyestrainstableboyleastwayssteadyingasymmetrycityscapesyncopateausterelyartlesslypederastyteasinglytyranniseoverhastyplaymatesautolyzes
...View all with 9 letters...
Phrases (35)
body wastehair stylecase studyadp systembay statergas systemsafety netsafety nutstay freshpotty seat
...View all with 9 letters...
Words (357)
absolutelystrawberryhystericalbabysitterseparatelyspecialitysympathizesystematicsensualitypleasantlystationerymistakenlystealthilystuyvesanteucalyptussyndicatedsympathiseelasticitysoothsayeryardmasteroverstayedmastectomyasphyxiatetastefullyasymmetricsalicylatepleasantryisocyanatedepositarymetaphysicflyswatterwastefullyyesteryearsyncopatedmanifestly
...View all with 10 letters...
Phrases (67)
yves tanguylead astraysmart moneyeaster lilyhouse partybeauty spotmaster copytake it easybasil thymegenus typha
...View all with 10 letters...
Words (420)
personalityessentiallydesperatelysympatheticobservatoryrespiratorysymmetricalspontaneityincessantlymetaphysicscrystallinegastrectomybathyspheresedimentarysystematicssynesthesiaasphyxiatedsympathizersteadfastlyschenectadyfeasibilitybisexualityversatilityobstinatelyancestrallymasterfullyrespectablysympathisersympathisedkeyboardistheartlesslycrystallizefacetiouslyskepticallysteerageway
...View all with 11 letters...
Phrases (96)
laying wastebody servantgenus styraxbicycle seatsouth by easteast by southvena cysticacoyote statesweat equityeaster bunny
...View all with 11 letters...
Words (480)
passionatelyconservatorymetaphysicalhystericallytransparencyclytemnestracrystallizedasymmetricalpresbyteriandomesticallydesirabilityoutrageouslybreathlesslypraiseworthychrestomathycompensatorypsychoactivestaggeringlyextrasensorysystematizederythematousdemonstrablymajesticallyunpleasantlyuniversalityexhaustivelysequentiallyecstaticallybreathalyserhypnotisablesubspecialtytransverselyconsummatelyperspicacitytracheostomy
...View all with 12 letters...
Phrases (142)
staying powerearnest moneyphantasy lifewaste of moneytreasury billtreasury noteanas clypeatagenus apteryxgenus tayassubrewer's yeast
...View all with 12 letters...
Words (472)
homosexualityspontaneouslychrysanthemumgynaecologistpsychotherapyrealisticallystrategicallyphysiotherapyspectacularlysupplementaryeverlastinglystereotypicaldiscretionaryunsympatheticaestheticallyintravenouslysensationallysymmetricallyaccessibilitysympathectomysentimentallyprostatectomyexistentiallytransparentlysyntheticallytreacherouslypyrophosphatesuperlativelymagisteriallysoutheasterlyconsideratelygeostationarynortheasterlyincontestablyclandestinely
...View all with 13 letters...
Phrases (179)
aleatory musicauditory sensecustody battlesystem commandbrandy snifterbody substancespiny anteaterwaste of energytaste propertyacrylate resin
...View all with 13 letters...
Words (405)
simultaneouslyscientificallysystematicallyunderstandablysentimentalityrespectabilityunquestionablyundersecretarythermodynamicsconservativelysubcutaneouslysupernaturallymetaphysicallynarcosynthesisdimensionalitysuperficialityphosphorylatedidealisticallyplethysmographostentatiouslyhydrotherapistanesthesiologyunhesitatinglypraiseworthilybiosystematicsdisconsolatelyconsuetudinaryasymmetricallyserviceabilitypachydermatousadvantageouslystretchabilityabsentmindedlyphosphorylatescytotaxonomies
...View all with 14 letters...
Phrases (210)
anthony burgessbattle of nasebysabbatical yearvisual propertyskeletal systemdrainage systemabstract entityclassical stylemost especiallyparts inventory
...View all with 14 letters...
Words (302)
psychotherapistinstantaneouslyanaesthesiologyphysiotherapistheterosexualitysympathomimeticsynergisticallyinaccessibilityinfinitesimallyinstrumentalitycontroversiallycytomegaloviruscompassionatelyrecrystallizingpostoperativelypolyunsaturateddemonstrativelysympatheticallydispassionatelyinconsideratelyeuphemisticallyneuropsychiatrypessimisticallyvoyeuristicallysymmetricalnessimperishabilitysystematizationkinestheticallyinsurrectionaryunsymmetricallydemonstrabilitysemidocumentarycommiseratinglyemployabilitiesdemystification
...View all with 15 letters...
Phrases (266)
auditory ossiclestay of executioncentaurea cyanusalimentary pastewystan hugh audenorycteropus aferlycosa tarentulawassily leontiefsolemnity of marystonecrop family
...View all with 15 letters...
Words (142)
enthusiasticallyindiscriminatelyquintessentiallysphygmomanometererythroblastosisextemporaneouslythermostaticallysurrealisticallyconversationallyneuropsychiatrichypersalivationsinextinguishablycommensurabilityhypersexualitiesinexhaustibilitythermoplasticityunostentatiouslyhyperstimulatinghyperstimulationadministrativelyparasympatheticshypervitaminosessphygmomanometryarchaeoastronomymonotheisticallycrossopterygianscryopreservationindispensabilitylyginopteridalesstenographicallyflabbergastinglystereophonicallyecclesiasticallygastroenterologycyanoethylations
...View all with 16 letters...
Phrases (256)
in a beastly mannerstrictly speakingchristian huygensgenus crotaphytusbluegrass countryhypophyseal stalkfamily locustidaeacross the countrywoolly plant lousenevil shute norway
...View all with 16 letters...
Words (87)
materialisticallycardiorespiratoryelectrostaticallycontemporaneouslyinconsequentiallypsychotherapeuticinterdisciplinaryhyperreactivitiesself-contradictoryisoelectronicallyphysiotherapeutichyperstimulationsspectroscopicallyhyperventilationssphygmomanometershypnotizabilitiesthrombocytopeniasmonosyllabicitiespaternalisticallypathophysiologieshyposensitizationunderstandabilitycryopreservationscryptocrystallineencephalomyelitiscrystallographerscrystallographiespostrevolutionarydisrespectabilitylymphadenopathiesgastroenterostomycytomegalovirusesuncontroversiallyrecrystallizationbathythermographs
...View all with 17 letters...
Phrases (299)
balaena mysticetusinterstate highwaypearly everlastingtheological systemcylinder separatorpetasites hybridusinvestment companygettysburg addressanemone sylvestrisuniversity of paris
...View all with 17 letters...
Words (55)
characteristicallydisproportionatelyinconsequentialityhyperaldosteronismpolyesterificationhypersensitizationspectroheliographypsychotherapeuticssphygmomanometrieshyposensitizationspentylenetetrazolscylindrical-stemmedstereospecificallystoichiometricallypteridospermaphytarecrystallizationshypercholesteremiasaccharomycetaceaemagnetostrictivelydehydrochlorinatesgranulocytopoiesesspectrographicallygranulocytopoiesisaerothermodynamicsrepresentationallyneuropsychiatristselectromyographiesdemythologizationsheavyheartednessesmethylnaphthalenesincommensurabilitydephosphorylationshomobasidiomycetespseudoparenchymatachlortetracyclines
...View all with 18 letters...
Phrases (301)
administrative bodyfamily physeteridaedame sybil thorndikelachrymal secretiongenus styracosaurusposterior pituitarynavigational systemcolumbia universitymary wollstonecraftclass schizomycetes
...View all with 18 letters...
Words (34)
hyperparathyroidismpolyesterificationshypersensitizationsextralinguisticallyparathyroidectomiesnonrelativisticallyconceptualisticallycytopathogenicitiesphenomenalisticallyphosphatidylcholineelectrodynamometersphosphoenolpyruvatecontradistinctivelythird-dimensionalityhysterosalpingogramthree-dimensionalityimpressionisticallymethylcholanthrenesencephalomyelitidesparasympathomimeticdiethylcarbamazinesphytohemagglutininshyperconcentrationstetramethyldiarsinehypoadrenocorticismdimethylnitrosaminepsychotomimeticallyhyperemotionalitiesdimethyltryptamineshyperexcitabilitiesexhibitionisticallyhyperirritabilitiesexpressionisticallymultidimensionalityPhrases (262)
acetylsalicylic acidseventeen-year locusthydrastis canadensisgiles lytton stracheyfamily lepisosteidaezairese monetary unitfamily dasyproctidaejacques yves cousteaugenus cryptobranchusavogadro's hypothesis
...View all with 19 letters...
Words (28)
uncharacteristicallyhypercholesterolemiaoverenthusiasticallyhyperadrenocorticismcytodifferentiationslymphogranulomatosesmagnetofluiddynamicsbacteriochlorophyllsphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesphosphoenolpyruvatesneuropsychiatricallymagnetohydrodynamicselectrophysiologicalmicrocrystallinitiesencephalomyocarditispseudoparenchymatoushydrochlorothiazidessyncategorematicallyhypercoagulabilitiesdimethylnitrosaminesheterobasidiomycetesplethysmographicallyexistentialisticallyhyperparathyroidismsPhrases (231)
william stanley jevonsyellow-shafted flickerwyethia amplexicaulisorder mycelia sterilialebanese monetary unitorder myxobacterialesbalaenoptera physalusdivision tracheophytabalance sheet analysisuniversity of nebraska
...View all with 20 letters...
Words (8)
stereomicroscopicallyalkylbenzenesulfonateacetylcholinesterasesotorhinolaryngologiesintersubstitutabilityhypercholesterolemiaspsychotherapeuticallytetrahydrocannabinolsPhrases (173)
aleksandr solzhenitsynmalaysian monetary unithelichrysum bracteatumsri lankan monetary uniteucalyptus fraxinoidesisle royal national parkcapital of pennsylvaniaparty to the transactioncucurbita argyrospermastrawberry haemangioma
...View all with 21 letters...
Words (4)
spectrophotometricallycarboxymethylcelluloseelectrophysiologicallyencephalomyocarditisesPhrases (157)
haliaeetus leucorhyphusaleksandr i. solzhenitsynaccessory before the factloyalist volunteer forcesodium tripolyphosphaterhythm and blues musicianathyrium thelypteroidesmale reproductive systemsurinamese monetary unitfamily branchiostomidae
...View all with 22 letters...
Words (2)
carboxymethylcelluloseshexamethylenetetraminesPhrases (121)
family threskiornithidaeposterior pituitary glandyellowstone national parkkazakhstani monetary unitcalycanthus occidentalisparis-sorbonne universitykyrgyzstani monetary unitbangladeshi monetary unitdorothy rothschild parkersouth korean monetary unit
...View all with 23 letters...
Words (3)
laryngotracheobronchitisphosphatidylethanolamineschizosaccharomycetaceaePhrases (91)
carnegie mellon universitylouis seymour bazett leakeysubdivision deuteromycotadivision heterokontophytasubphylum cephalochordatamary wollstonecraft godwinprimary sex characteristicsir terence mervyn rattiganbrassica oleracea botrytisexistentialist philosophy
...View all with 24 letters...
Words (1)
phosphatidylethanolaminesPhrases (84)
mary wollstonecraft shelleyfrancis scott key fitzgeraldpolystichum acrostichoidesmelanerpes erythrocephalusbeggar-my-neighbour strategycaulophyllum thalictroidestrans-alaska pipeline systemsir arthur stanley eddingtonandrei arsenevich tarkovskywestern samoan monetary unit
...View all with 25 letters...
Phrases (59)
hunting and gathering societysecretary of veterans affairsemployee stock ownership planevelyn arthur saint john waughcharles maurice de talleyrandsubdivision coniferophytinanewton's theory of gravitationsubdivision deuteromycotinabureau of diplomatic securitysystem of weights and measures
...View all with 26 letters...
Phrases (51)
business environment analysisnikita sergeyevich khrushchevaugustus welby northmore pugincommissioned military officernuclear regulatory commissiondeoxyadenosine monophosphatesecretary of commerce and labortricyclic antidepressant drugdeoxythymidine monophosphatejames augustine aloysius joyce
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (42)
revolutionary people's strugglemarcus junius brutus the youngerfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationmicrosoft disk operating systemfeodor mikhailovich dostoevskydepartment of homeland securitymaster of arts in library sciencedissident irish republican army
...View all with 28 letters...
Phrases (26)
business environmental analysisacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitscrutin uninominal voting systemmiddle east respiratory syndromehydrangea macrophylla hortensispresident william henry harrison
...View all with 29 letters...
Phrases (27)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepository financial institutionbalance of international paymentswaterhouse-friderichsen syndromesevere acute respiratory syndrome
...View all with 30 letters...
Phrases (13)
great smoky mountains national parkfreedom from involuntary servitudedigital communications technology2019-ncov acute respiratory diseaserevolutionary proletarian nucleusport-access coronary bypass surgeryprimary subtractive color for lightrichard august carl emil erlenmeyerfibrocystic disease of the pancreasmarine corps intelligence activity
...View all with 31 letters...
Phrases (20)
hierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory druguniversity of california at berkeleyprimary subtractive colour for lighttheory of electrolytic dissociation
...View all with 32 letters...
Phrases (13)
autonomous sensory meridian responselycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human servicespositron emission tomography scanner
...View all with 33 letters...
Phrases (10)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesdryopithecus rudapithecus hungaricusmassachusetts institute of technologyeinstein's general theory of relativityeinstein's special theory of relativitycomputerized axial tomography scannerrevolutionary armed forces of colombiaPhrases (9)
communications security establishmentrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence servicehereditary motor and sensory neuropathynational socialist german workers' partydepartment of defense laboratory systemfraxinus pennsylvanica subintegerrimaunited states naval research laboratoryPhrases (10)
jakob ludwig felix mendelssohn-bartholdysecretary of state for the home departmentangiotensin-converting enzyme inhibitorchurch of jesus christ of latter-day saintsnational geospatial-intelligence agencyjuan carlos victor maria de borbon y borbonfield-sequential color television systemtransportation security administrationsecretary of health education and welfaresocialist people's libyan arab jamahiriyaPhrases (12)
first epistle of paul the apostle to timothyuniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and sciencesdefense advanced research projects agencyus army criminal investigation laboratory
...View all with 37 letters...
