Words Containing: A,N,S,H,I,E,S
(In Any Order)
There are 1,492 words,
1,700 phrases and
0 abbr's with
A,N,S,H,I,E,S in.
Best Scoring
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| vanquishes | 10 | 25 | verbv | |||||
verb • come out better in a competition, race, or conflict | ||||||||
| hazinesses | 10 | 22 | nounn | |||||
noun • vagueness attributable to being not clearly defined • cloudiness resulting from haze or mist or vapor | ||||||||
| whipsnakes | 10 | 22 | nounn | |||||
noun • any of several small fast-moving snakes with long whiplike tails | ||||||||
| haziness | 8 | 20 | nounn | |||||
noun • vagueness attributable to being not clearly defined • cloudiness resulting from haze or mist or vapor | ||||||||
| handspikes | 10 | 20 | nounn | |||||
noun • a metal bar (or length of pipe) used as a lever | ||||||||
| mechanisms | 10 | 19 | nounn | |||||
noun • the atomic process that occurs during a chemical reaction • the technical aspects of doing something • a natural object resembling a machine in structure or function • (philosophy) the philosophical theory that all phenomena can be explained in terms of physical or biological causes • device consisting of a piece of machinery; has moving parts that perform some function | ||||||||
| sandwiches | 10 | 19 | nounn | |||||
noun • two (or more) slices of bread with a filling between them verb • make into a sandwich • insert or squeeze tightly between two people or objects | ||||||||
| snakefish | 9 | 19 | noun, adjectiven, adj | |||||
noun • tropical fishes with large mouths in lizard-like heads; found worldwide | ||||||||
| mischances | 10 | 19 | nounn | |||||
noun • an unpredictable outcome that is unfortunate • an instance of misfortune | ||||||||
| mineshafts | 10 | 18 | nounn | |||||
noun • excavation consisting of a vertical or sloping passageway for finding or mining ore or for ventilating a mine | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
hessianWords (57)
happinessskinheadsmisshapenheavinesssisypheanhastinessephesiansshakinesshairinesscharinesstarnishesanguishesgarnishesinsheathsthespiansapishnessvarnishesevanishesinswathesbanishersabsinthespanfishesplanisheshumanisesspinachesshinleafshandinessadhesionshardinesssnakefishheadinessvanishersshealingsshearingswashiness
...View all with 9 letters...
Words (120)
enthusiasmastonishedanesthesiaenthusiastantithesisgarishnessflashinessseamanshipsinghaleseshabbinesslavishnessrakishnessantithesesgarnishersinsheathesmineshaftsastonisheschancinessharmonisesselachiansvarnisherspatchinessshearlingsfashionersrefashionssheathingsvanquishesdianthusesmechanismsenravisheshandspikesmechanistssandwichesshanachiesshrinkages
...View all with 10 letters...
Phrases (6)
genus aphissquash vinehigh seasonspanish elmspanish teahessian flyWords (206)
unhappinessanaesthesianaughtinessanesthetistsynesthesiaparenthesismarchionesshealthinessmawkishnesskinesthesiasenatorshipshinplasterhaughtinessemphasisinggraphicnesspaunchinesswaggishnessghastlinesswealthinessmisshapenlythroatinessraffishnessshakinessesshenaniganssubheadingsstarchinessrevarnishesbanishmentsslavishnessspringheadspenmanshipsvanquishersmyasthenicsanestheticsdisenchants
...View all with 11 letters...
Phrases (15)
sensory hairgenus phaiusanise hyssopseat cushionchinese shanhoisin saucespanish limespanish ricehans fischersaint joseph
...View all with 11 letters...
Words (229)
enthusiastichairdressingastonishmentthessalonikifaithfulnessheartstringscalisthenicsanaestheticsgamesmanshipanaesthetistaristophanessalesmanshipalmightinesshorsemanshiptransshippedsnappishnessanaesthetisehelmsmanshipstraightnesschastisementsynaesthesiathessalonianstealthinessclannishnessdisfranchisefatherlinessadhesivenessphysicalnessheavenlinessparishionersstickhandlesflashinessesamphisbaenasfaintishnessspaghettinis
...View all with 12 letters...
Phrases (35)
chinese anisegenus xiphiasgenus arachisspanish heathsciaenid fishbasic englishthomas edisoncanister shotshore stationjoseph stalin
...View all with 12 letters...
Words (282)
establishmentthoracentesistransshipmentfaithlessnesselephantiasisblandishmentsleishmaniasisshakespearianpigheadednessstatesmanshipsqueamishnesshabitablenessdisfranchisedfoolhardinesswithdrawnnessastonishmentsphalansteriesdisfranchiseshaughtinessesnaughtinesseslightfastnesshilariousnessheadshrinkersrelationshipswaspishnesseswhitewashingsunearthlinesschastisementsstenographiesmisapprehendsunhappinessesstablishmentscheeseparingsadmonishmentsaestheticians
...View all with 13 letters...
Phrases (64)
genus anthemisgenus haemopisgenus haliotismexican hyssopspanish guineahenri rousseauspanish peopleacipenser husogaussian shapegenus dianthus
...View all with 13 letters...
Words (232)
cholinesteraseunfaithfulnessnarcosynthesisunenthusiasticdisenfranchisemechanicalnesshospitablenessfarsightednessanesthesiologyservomechanismunchangingnessoutlandishnessmethodicalnessreestablishingadhesivenesseswatertightnessbronchiectasesinchoatenessesmetaphysiciansantihistaminesmisemphasizinglandownershipshousebreakingsdiaphanousnesscharitablenessdwarfishnessesnonperishablesbigheartednessgastightnessesestablishmentschivalrousnessroadworthinessclearinghousescopartnershipscochairpersons
...View all with 14 letters...
Phrases (89)
sir joseph banksgaston lachaisefisherman's lurefrancis joseph ichinese parsleygenus phasianusshellac varnishchief assistantgenus hamamelisscorpaenid fish
...View all with 14 letters...
Words (173)
unsophisticateddisenfranchisedanaesthesiologymisapprehensionparthenogenesisinterscholasticdistinguishablelightheadednessnearsightednesskindheartednessadenohypophysisblameworthinessstandoffishnessaccomplishmentsreestablishmentschematizationstrisoctahedronsunderemphasizesanthroposophiesfashionablenesspigheadednessesfoolhardinessesdisheartenmentsservomechanismsmonosaccharidescholinesterasesapprenticeshipsdisestablishingoverenthusiasmschancellorshipsinheritablenessdisinheritancesseaworthinesseswithdrawnnessespunishabilities
...View all with 15 letters...
Phrases (132)
high renaissancedialysis machinehyoscyamus nigersnake in the grassacross the nationgenus charadriusii thessaloniansernst boris chainanthus pratensisgenus phragmites
...View all with 15 letters...
Words (58)
enthusiasticallyanesthesiologistoverenthusiasticlightheartednesshypersalivationsdisenfranchisingpraiseworthinesshypervitaminosesfarsightednessesfashionabilitiesimperishablenesssteprelationshiplymphangiectasisreestablishmentsold-fashionednessanti-aestheticismwatertightnessesestablishmentismconservatorshipsbigheartednessesinharmoniousnessphosphocreatinesreorchestrationsinhospitablenessoutlandishnesseshelminthostachysdisestablishmentamateurishnessesamphibiousnessesmethodicalnessesapprehensivenessharmoniousnessesanesthesiologiesdisfranchisementhendecasyllabics
...View all with 16 letters...
Phrases (129)
christian huygenshelianthus annuuschemical analysischristmas presentgenus cheilanthesgenus cheiranthusmechanical stressmechanical systemschool assignmentoscar hammerstein
...View all with 16 letters...
Words (37)
indistinguishablekindheartednessesdisestablishmentshyperstimulationsdisfranchisementsinheritablenessescrashworthinessesfashionablenessesarchconservativeshyposensitizationstandoffishnessesphilosophicalnessmachine-accessibleauthoritativenesspharisaicalnessesnearsightednessesacquaintanceshipsneuropathologistsblameworthinessesundistinguishableneuropsychiatriesneuropsychiatristdesynchronisationanesthesiologistsanthropocentrismsultrasonographiesphotorespirationsdishonourablenessepiphenomenalismsantiestablishmentsemipornographiesantihypertensiveshalf-consciousnessnonestablishmentsunfashionableness
...View all with 17 letters...
Phrases (152)
primary censorshipdianthus deltoideslouisiana purchasetrichechus manatusgenus phalaenopsischristopher carsonlophius americanusgenus acridotheressinhalese languagehigh-strength brass
...View all with 17 letters...
Words (32)
hyperaldosteronismdisenfranchisementhypersensitizationinharmoniousnessesinhospitablenessesdishonorablenessesfaintheartednessesapprehensivenessessphygmomanometriesarchaeoastronomieshyposensitizationslightheartednessespraiseworthinessesaustralopithecinesbacteriorhodopsinsrehospitalizationscharacteristicnessdehydrochlorinasesmechanochemistriesimperishablenessesneuropsychiatristsanticholinesterasephotodisintegratesdephosphorylationsinterrelationshipsindustrial-strengthuncharitablenessesphotosensitizationestablishmentarianunenthusiasticallyinexhaustibilitiesirreproachablenessPhrases (148)
sir martin frobishersir matthew flinderspolianthes tuberosanational censorshipgenus chamaecytisusascension of the lordaugustinian hermitsstinking nightshadeoscar hammerstein iiarthur m. schlesinger
...View all with 18 letters...
Words (16)
straightforwardnessdisenfranchisementshypersensitizationsauthoritativenessesimmunohematologistsphosphofructokinasecontradistinguishedcontradistinguisheshysterosalpingogramanticholinesterasesphotoreconnaissancephotosensitizationsestablishmentariansinterchangeablenessunfashionablenessesinexhaustiblenessesPhrases (132)
hydrastis canadensisallium schoenoprasumgiles lytton stracheygenus symphoricarposhelianthus tuberosuspounds per square inchtransmission channelsecondary censorshipspanish monetary unitgenus delphinapterus
...View all with 19 letters...
Words (16)
overenthusiasticallydistinguishabilitiesacetylcholinesterasephosphatidylcholinesphosphofructokinasesneuropharmacologistsphotodisintegrationspseudocholinesteraseantiestablishmentismphotoreconnaissancespseudosophisticationnephroangiosclerosisdimethylnitrosaminespaleoanthropologistsirreproachablenessesmischaracterizationsPhrases (124)
business relationshipbalance sheet analysissphenisciform seabirdneisseria gonorrhoeaecantharellus cibariusmilton snavely hersheythousand and one nightsindochinese peninsulaluscinia megarhynchoscharadrius morinellus
...View all with 20 letters...
Words (8)
disestablishmentarianstraightforwardnessesestablishmentarianisminterchangeablenessesacetylcholinesterasespseudocholinesterasespseudosophisticationsindistinguishablenessPhrases (120)
sir john everett millaisaleksandr solzhenitsynanthriscus cereifoliumanigozanthus manglesiitransmission mechanismphascolarctos cinereusarithmetic progressionhenry hobson richardsonfranz joseph i of austriaintravenous anesthetic
...View all with 21 letters...
Words (4)
disestablishmentariansencephalomyocarditisesestablishmentarianismsindistinguishabilitiesPhrases (100)
leishmaniasis americanaaleksandr i. solzhenitsynviola tricolor hortensisrhythm and blues musicianfrancois charles mauriacthousand island dressingcharacter assassinationarthur meier schlesingergotthold ephraim lessingengraulis encrasicholus
...View all with 22 letters...
Words (1)
indistinguishablenessesPhrases (65)
parenthetical expressiontransient ischemic attackcalycanthus occidentalisaristolochia serpentariasarvepalli radhakrishnanhenri emile benoit matissetyrosine kinase inhibitorrichard brinsley sheridancervus elaphus canadensischronological succession
...View all with 23 letters...
Phrases (66)
argyroxiphium sandwicensebattle of the spanish armadaarthur meier schlesinger jr.existentialist philosophyhypersensitivity reactioncharles augustus lindberghcharles camille saint-saensalgernon charles swinburnesir charles leonard woolleysir charles william siemens
...View all with 24 letters...
Words (2)
phosphatidylethanolaminesantiestablishmentarianismPhrases (62)
battle of the chemin-des-damescruel and unusual punishmentdistinguished service medalboris leonidovich pasternakrudolf christian karl dieselwar of the spanish successionsaddam bin hussein at-takritiherpes simplex encephalitissir arthur stanley eddingtonandrei arsenevich tarkovsky
...View all with 25 letters...
Phrases (46)
helen maria fiske hunt jacksonchannel islands national parkfrances eliza hodgson burnettshort-spurred fragrant orchidsir sarvepalli radhakrishnannational institutes of healthwar of the austrian successionjames abbott mcneill whistleremployee stock ownership plansir charles scott sherrington
...View all with 26 letters...
Phrases (29)
nikita sergeyevich khrushchevaleksandr sergeyevich pushkinaugustus welby northmore puginfreedom from search and seizurejerusalem artichoke sunflowerdeoxyadenosine monophosphatecryptobranchus alleganiensistaras grigoryevich shevchenkohomo sapiens neanderthalensisstationary stochastic process
...View all with 27 letters...
Phrases (35)
aleksandr feodorovich kerenskyephippiorhynchus senegalensismarcus junius brutus the youngerdistinguishing characteristiccommission on the status of womenjohan julius christian sibeliusfederal housing administrationludwig josef johan wittgensteinsergei mikhailovich eisensteindissident irish republican army
...View all with 28 letters...
Phrases (22)
aleksandr nikolayevich scriabindisorganized type schizophreniacapital of the russian federationhydrangea macrophylla hortensisconstitution of the united statespresident william henry harrisonsecond epistle to the corinthiansgeorges joseph christian simenonarrhenius theory of dissociationsecondary sexual characteristic
...View all with 29 letters...
Phrases (19)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library sciencedouble standard of sexual behaviorjacques anatole francois thibaultaugust friedrich leopold weismannwaterhouse-friderichsen syndromeplasma thromboplastin antecedenthenri rene albert guy de maupassant
...View all with 30 letters...
Phrases (16)
united states public health servicesecond epistle to the thessaloniansmarie louise elisabeth vigee-lebrunsir john frederick william herschelanicius manlius severinus boethiusislamic jihad movement in palestineoscar fingal o'flahertie wills wildefrancoise-athenais de rochechouartcommonwealth of independent statesfibrocystic disease of the pancreas
...View all with 31 letters...
Phrases (11)
nikolai andreyevich rimski-korsakovhierarchical classification systemsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovtheory of electrolytic dissociationyevgeni aleksandrovich yevtushenkowilhelm apollinaris de kostrowitzkiprogressive emphysematous necrosisattorney general of the united stateschrysanthemum coronarium spatiosum
...View all with 32 letters...
Phrases (12)
epistle of paul the apostle to philemonorganization of the oppressed on earthelizabeth cleghorn stevenson gaskellsir winston leonard spenser churchillkonstantin sergeyevich stanislavskydisease of the neuromuscular junctionmercury-in-glass clinical thermometersecretary of health and human servicespositron emission tomography scannersubacute inclusion body encephalitis
...View all with 33 letters...
Phrases (14)
jacques francois fromental elie halevychronic obstructive pulmonary diseaseepistle of paul the apostle to the romansinterstitial cell-stimulating hormonemusculus sphincter ductus pancreaticifriedrich august kekule von stradonitzdryopithecus rudapithecus hungaricusmassachusetts institute of technologydepartment of health and human servicesassociation of southeast asian nations
...View all with 34 letters...
Phrases (9)
national baseball hall of fame and museumjohann christoph friedrich von schillercommunications security establishmentcomte donatien alphonse francois de sadehereditary motor and sensory neuropathytransurethral resection of the prostatesubacute sclerosing leukoencephalitisselective-serotonin reuptake inhibitorunited states naval research laboratory
