Words Containing: A,M,E,S,H
(In Any Order)
There are 3,623 words,
2,927 phrases and
0 abbr's with
A,M,E,S,H in.
Best Scoring Words With: A,M,E,S,H
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| mayhems | 7 | 17 | nounn | |||||
noun • the willful and unlawful crippling or mutilation of another person • violent and needless disturbance | ||||||||
| hakeems | 7 | 16 | ||||||
noun • a Muslim physician | ||||||||
| samekhs | 7 | 16 | nounn | |||||
noun • the 15th letter of the Hebrew alphabet | ||||||||
| samekh | 6 | 15 | noun, adjectiven, adj | |||||
noun • the 15th letter of the Hebrew alphabet | ||||||||
| chasmed | 7 | 15 | verb, adjectivev, adj | |||||
Valid word for Scrabble US
| ||||||||
| shammed | 7 | 15 | verbv | |||||
noun • something that is a counterfeit; not what it seems to be • a person who makes deceitful pretenses adjective satellite • adopted in order to deceive verb • make a pretence of • make believe with the intent to deceive | ||||||||
| marches | 7 | 14 | verb, nounv, n | |||||
noun • a region in central Italy, with capital Ancona | ||||||||
| schmear | 7 | 14 | verb, nounv, n | |||||
noun • (Yiddish) a batch of things that go together | ||||||||
| beamish | 7 | 14 | adjectiveadj | |||||
adjective satellite • smiling with happiness or optimism | ||||||||
| shamble | 7 | 14 | verb, nounv, n | |||||
noun • walking with a slow dragging motion without lifting your feet verb • walk by dragging one's feet | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (71)
ashamedsmashedmessiahshermanhamstermarchesatheismsmasherschmearishmaelgreshammishearbeamishshamblemeshugaschemassmasheshomageshetmansmarshesshmearsmayhemssachemsanthemsheaumesharmersohmagesbeshamematchesmaihemsshammermashersmashieschasmedshammed
...View all with 7 letters...
Phrases (1)
sea holmWords (171)
handsomesomewhatharmlesschambersfreshmanmustacheshamefulhorsemanmadhousefamishedemphasisshamblescashmerememsahibmachetesheadsmanseraphimhousemanherdsmanmisheardhelmsmanhemostatamethystsydenhamchampersmeshuggaischemiamastheadwelshmanshamisenmateshipshipmatehumanisemarchesachessman
...View all with 8 letters...
Phrases (11)
mess hallsea nymphmash beanmarsh hengame fishfish mealhead smuthome basemarsh peamarsh tea
...View all with 8 letters...
Words (330)
moustacheshamelessfishermanmechanicsmechanismblasphemyfarmhouseemphasizehampshiremisbehavealchemistmilkshakehousemaidsqueamishshoemakermakeshiftcatechismemphysemaloathsomeblasphemehomesteadgilgameshschematicemphasisemisshapenhousematemarrakeshmatchlesshandsomerempathiselampshadehistaminehumannessclamshellmineshaft
...View all with 9 letters...
Phrases (42)
sketch mapmale horsetest matchamish sectmarsh fernmarsh harechess gamemilk shakepesh mergaflame bush
...View all with 9 letters...
Words (453)
atmospherehomosexualmanchesterenthusiasmheadmasterharassmentenglishmansympathizesuperhumanschoolmaterheumatismhandsomelymisbehavedarchimedesbanishmentblasphemerthermostatemphasizedhandsomestsympathisepenmanshipamateurishlachrymosemeerschaummunchausenhumanitieshemostasismethuselahblasphemedschlimazelmechanisedshamefullymismatchedshirtmakerhemostatic
...View all with 10 letters...
Phrases (52)
white camasmoshe dayanslim chancesam shepardshame plantsmart phoneall the samemarsh cresschild's gamehenry james
...View all with 10 letters...
Words (534)
mathematicsmerchandisesympatheticscaramoucheatmosphericstomachacheshamelesslyblasphemousmisbehavingmetaphysicsmisanthropemustachioedhousemasterathleticismspeechmakersympathizergarnishmenthomesteadermisbehaviorcomradeshipblaspheminghomeostasisseismographwasherwomanmarchionessdeutschmarkemphasizingunashamedlysympathisersympathisedabolishmenthammersteinbehaviorismmawkishnessthalassemia
...View all with 11 letters...
Phrases (81)
great schismmary shelleyanemone fishfemale chestfemale horseman-on-a-horsehorse balsamhorse manurehouse martingenus mentha
...View all with 11 letters...
Words (523)
accomplishedmanslaughterheadmistressmetaphysicalhousewarmingsledgehammerastonishmentschoolmastermalnourishedspeechmakingmerchandisermisbehaviourgamesmanshipchrestomathyenglishwomanhaemorrhoidslongshoremansalesmanshiperythematousalmightinesshorsemanshiphandsomenessdehumanisingmetamorphosegemeinschaftaestheticismarsphenaminedysmenorrheaoveremphasishelmsmanshiphematologistchastisementatmosphericstracheostomysemidetached
...View all with 12 letters...
Phrases (124)
genus anethummount shermanprotest marchgenus mahoniagenus chamaeabenjamin rushhome invasionmusic teachermass hysteriaanise camphor
...View all with 12 letters...
Words (487)
establishmentmassachusettshomosexualitymetamorphosismerchandisingchrysanthemummagnetospherechristmastimeshamelessnessantihistamineunsympatheticsympathectomymetamorphosesthermoplastictransshipmenthaematologistloathsomenessdexamethasoneblandishmentsseismographicleishmaniasispharmaceuticsstatesmanshipsqueamishnesssaccharomycesaeromechanicsmesencephalonhematopoiesisanalphabetismcommandershipspermatophyteholidaymakersaccomplishersastonishmentshematophagous
...View all with 13 letters...
Phrases (159)
john masefieldhard-shell clamgenus anthemismachine stitchchristmas cakestealth bomberos scaphoideumbenjamin shahnchristmas treesir thomas more
...View all with 13 letters...
Words (434)
accomplishmentthermodynamicsmetaphysicallyunaccomplisheddisenchantmentheadmastershipmechanicalnessplethysmographoveremphasizedservomechanismmalnourishmenthippopotamusesomphaloskepsisshamefacednessaccomplishablemonosaccharidepachydermatousdisheartenmentmethodicalnessholometabolismchromaticitieshemerocallisesheadmistressesaminophyllineshypermasculineunderemphasizehypermetropiasmetamorphosinghandicraftsmenbremsstrahlungencephalogramsmischannellingtheatricalismscinematographsmetaphysicians
...View all with 14 letters...
Phrases (193)
fisherman's lurechristmas bellsgenus chamaeleomale chauvinistrobert schumannachromatic lensgenus mammuthusphleum pratensegenus hamamelisorder rhamnales
...View all with 14 letters...
Words (280)
misapprehensionsympathomimeticenfranchisementplainclothesmansympatheticallyeuphemisticallyimperishabilityhermaphroditismblameworthinesswarmheartednessblasphemousnessaccomplishmentsreestablishmentechinodermatousschoolmasterishmetallographiesnonachievementsdehumanizationsschematizationsanthropometriesposthemorrhagicunderemphasizedunderemphasizesepitheliomatousmethylxanthineschlorpromazinesmischaracterizeschistosomiasesdisheartenmentshemoflagellatespsychometricianmisapprehendingservomechanismshyperstimulatedhyperstimulates
...View all with 15 letters...
Phrases (237)
dialysis machinemrs. humphrey wardgenus gnaphaliumacheta assimilisacheta domesticahyoscyamus nigerspiny-headed wormdashiell hammettpinchas zukermanchemical defense
...View all with 15 letters...
Words (124)
sphygmomanometerthermostaticallyepiphenomenalismanthropomorphisenorthamptonshirethermolabilitiesradiochemistriesspectroheliogramextrachromosomalthermoplasticityhyperstimulatingheterometabolismhyperstimulationheterometabolousthermoregulatorsmachiavellianismparasympatheticsthermoremanenceshypervitaminosessphygmomanometryarchaeoastronomyfathomlessnessesmonotheisticallyanthropocentrismrechromatographsmuddleheadednessimperishablenesscyclohexylaminescyclophosphamidenortheasternmostmachineabilitiespharmacogeneticspharmacokineticswatermelon-shapeddithiocarbamates
...View all with 16 letters...
Phrases (255)
manihot esculentadelphinium ajacisw. somerset maughamstephane mallarmechemical analysismephitis macrouragenus chaenomelesrubus chamaemorussodium thiopentalchristmas disease
...View all with 16 letters...
Words (59)
nonmathematiciansspectroheliogramsparaformaldehydesdisestablishmentshyperstimulationsthermoregulationsdisfranchisementsthermostabilitiessphygmomanometersthrombocytopeniasencephalomyelitismachine-accessiblelymphadenopathiescyclophosphamidespharmacotherapiesbathythermographswarmheartednessesimmunopathologiesphenylethylaminespheochromocytomasdehumidificationsbiomathematiciansmechanoreceptionsimperishabilitiestriphenylmethanesblameworthinessesblasphemousnessesmerchantabilitiesunsympatheticallybronchopneumoniasmesembryanthemumsmetapsychologicalelectropherogramsmacrorhamphosidaehemagglutinations
...View all with 17 letters...
Phrases (245)
heat of sublimationpast-tense morphemehashimoto's diseasearchibald macleishgenus symphalangustheological systemprimary censorshipline of merchandisechemical mechanismtrichechus manatus
...View all with 17 letters...
Words (47)
hyperaldosteronismdisenfranchisementpolymorphonuclearsthermoplasticitiesinharmoniousnessesmonochromaticitiessphygmomanometriesarchaeoastronomiesrechromatographiesmuddleheadednesseslymphangiographiesstoichiometricallypteridospermaphytamacrophotographiesmucopolysaccharideimmunohematologiesimmunohematologisthypercholesteremiasaccharomycetaceaeplasmodiophoraceaemechanochemistriesimperishablenessesphosphoglucomutaseaerothermodynamicselectromyographiesdemythologizationsmethemoglobinemiasmethylnaphthaleneshemoglobinopathiesphotomicrographieshomobasidiomyceteshomoscedasticitiespseudoparenchymatadextroamphetamineshydrometallurgists
...View all with 18 letters...
Phrases (278)
washington monumentphotographer's modelfamily physeteridaedame sybil thorndikelachrymal secretionmount rushmore stateclass schizomycetessir martin frobishersir matthew flinderslepomis macrochirus
...View all with 18 letters...
Words (38)
hyperparathyroidismpseudohermaphroditedisenfranchisementsparathyroidectomiesencephalomeningitismucopolysaccharidesanarcho-collectivismimmunohematologistsimmunohistochemicalphenomenalisticallyneuropharmacologiesneuropharmacologistphosphoglucomutasesphosphomonoesterasethird-dimensionalityhysterosalpingogramthree-dimensionalitymeningoencephalitiselectrophoretogramsmethylcholanthreneshemidemisemiquaversmakataimeshekiakiakencephalomyelitideschromolithographersparasympathomimeticchromolithographiesestablishmentariansdiethylcarbamazinesphytohemagglutininstetramethyldiarsinehypoadrenocorticismphacoemulsificationdimethylnitrosaminepsychotomimeticallyhyperemotionalities
...View all with 19 letters...
Phrases (214)
allium schoenoprasumgenus symphoricarposbattle of saint-mihielstephen michael reichchinese monetary unitbattle of the metaurussymphytum officinaletransmission channelsubfamily mephitinaetragelaphus imberbis
...View all with 19 letters...
Words (24)
hypercholesterolemiasemiautobiographicalradiopharmaceuticalsspectrophotometricalhyperadrenocorticismlymphogranulomatosesphenylpropanolaminesphenylthiocarbamidespseudohermaphroditicoophorosalpingectomyneuropharmacologistsphosphomonoesterasesmagnetohydrodynamicshistocompatibilitiesencephalomyocarditisantiestablishmentismchlorofluoromethanespseudoparenchymatouspsychopharmacologiesdimethylnitrosaminesheterobasidiomycetesplethysmographicallyhyperparathyroidismsmischaracterizationsPhrases (180)
archeological remainswyethia amplexicaulisabelmoschus moschatusphotographic emulsionwalther hermann nernstsphenisciform seabirdislamic calendar monthgeorges henri lemaitrepoor man's weatherglassmechanically skillful
...View all with 20 letters...
Words (6)
disestablishmentarianestablishmentarianismpseudohermaphroditismelectroencephalogramsmeningoencephalitideshypercholesterolemiasPhrases (187)
acrocentric chromosomesir john everett millaisabelmoschus esculentusadministrative hearinghelianthemum scopariumanaphalis margaritaceaanthriscus cereifoliumhelichrysum bracteatumanigozanthus manglesiistephen william hawking
...View all with 21 letters...
Words (5)
disestablishmentariansspectrophotometricallycarboxymethylcelluloseencephalomyocarditisesestablishmentarianismsPhrases (143)
schlumbergera truncatusleishmaniasis americanaherbert marshall mcluhansodium tripolyphosphatebattle of the bismarck searhythm and blues musicianathyrium thelypteroidescapital of massachusettsmusculus triceps brachiifrancois charles mauriac
...View all with 22 letters...
Words (2)
carboxymethylcelluloseshexamethylenetetraminesPhrases (101)
family threskiornithidaetransient ischemic attacktribasic sodium phosphateaugust wilhelm von hofmannkazakhstani monetary unitthiopentobarbital sodiumhenri emile benoit matissebangladeshi monetary unitsouth korean monetary unitgroup pteridospermaphyta
...View all with 23 letters...
Words (3)
phosphatidylethanolaminedichlorodifluoromethanesschizosaccharomycetaceaePhrases (92)
basque homeland and freedompelham grenville wodehouseargyroxiphium sandwicensesubphylum cephalochordataprimary sex characteristicbattle of the spanish armadaarthur meier schlesinger jr.commonwealth of the bahamasrichard buckminster fullertechnology administration
...View all with 24 letters...
Words (2)
phosphatidylethanolaminesantiestablishmentarianismPhrases (63)
embryonal rhabdomyosarcomamary wollstonecraft shelleybattle of the chemin-des-dameschemical weapons conventioncruel and unusual punishmentdistinguished service medalpolystichum acrostichoidesmelanerpes erythrocephalusbeggar-my-neighbour strategysaddam bin hussein at-takriti
...View all with 25 letters...
Phrases (47)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanbattle of monmouth court housebacon-lettuce-tomato sandwichjames abbott mcneill whistlerhuman immunodeficiency virusemployee stock ownership planandrei dimitrievich sakharovcharles maurice de talleyrandsystem of weights and measures
...View all with 26 letters...
Phrases (39)
electromechanical transduceraugustus welby northmore puginfreedom from search and seizurejerusalem artichoke sunflowerdeoxyadenosine monophosphatedeoxythymidine monophosphatethyrotropin-releasing hormonehomo sapiens neanderthalensissir frederick william herschelthrough empirical observation
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (38)
marcus junius brutus the youngerfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycommission on the status of womenfederal housing administrationfeodor mikhailovich dostoevskifeodor mikhailovich dostoevskydepartment of homeland securitysergei mikhailovich eisensteindissident irish republican army
...View all with 28 letters...
Phrases (21)
chemical decomposition reactionfriedrich wilhelm august froebeldmitri dmitrievich shostakovichsao thome e principe monetary unitferdinand joseph la menthe mortonhydrangea macrophylla hortensispresident william henry harrisongeorges joseph christian simenontripleurospermum tchihatchewiifyodor mikhailovich dostoyevsky
...View all with 29 letters...
Phrases (19)
valentina vladmirovna tereshkovaaleksandr mikjailovich prokhorovaugust friedrich leopold weismannwaterhouse-friderichsen syndromeplasma thromboplastin antecedentmucocutaneous lymph node syndromeesther hobart mcquigg slack morrishenri rene albert guy de maupassantdag hjalmar agne carl hammarskjoldalfred charles william harmsworth
...View all with 30 letters...
Phrases (14)
marie louise elisabeth vigee-lebrundigital communications technologysir john frederick william herschelanicius manlius severinus boethiusprimary subtractive color for lightislamic jihad movement in palestinewernher magnus maximilian von brauncommonwealth of independent statesrichard august carl emil erlenmeyerarmenian apostolic orthodox church
...View all with 31 letters...
Words (1)
tetrabromo-phenolsulfonephthaleinPhrases (14)
nikolai andreyevich rimski-korsakovafrican american vernacular englishhierarchical classification systemstraight-line method of depreciationnikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylateprimary subtractive colour for lightedmond louis antoine huot de goncourtoculopharyngeal muscular dystrophywilhelm apollinaris de kostrowitzki
...View all with 32 letters...
Phrases (9)
characteristic root of a square matrixepistle of paul the apostle to philemonbureau of alcohol tobacco and firearmsdisease of the neuromuscular junctionmercury-in-glass clinical thermometersecretary of health and human servicespositron emission tomography scannerhimantopus himantopus leucocephalusdefense technical information centerPhrases (10)
jacques francois fromental elie halevychronic obstructive pulmonary diseasefederal islamic republic of the comorosepistle of paul the apostle to the romansinterstitial cell-stimulating hormonemusculus sphincter ductus pancreaticimassachusetts institute of technologydepartment of health and human servicesbaron hugh caswall tremenheere dowdingcomputerized axial tomography scannerPhrases (8)
jakob ludwig felix mendelssohn-bartholdysecretary of state for the home departmentangiotensin-converting enzyme inhibitorfreedom from cruel and unusual punishmenttripleurospermum oreades tchihatchewiialbert francis charles augustus emmanuelsocialist people's libyan arab jamahiriyabaron karl maria friedrich ernst von weber
