Words Containing: A,L,I,Y,A
(In Any Order)
There are 2,619 words,
3,915 phrases and
0 abbr's with
A,L,I,Y,A in.
Best Scoring Words With: A,L,I,Y,A
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
axially | 7 | 17 | adverb, adjectiveadv, adj | |||||
adverb • with respect to an axis | ||||||||
waylaid | 7 | 14 | verbv | |||||
verb • wait in hiding to attack | ||||||||
amiably | 7 | 14 | adverb, adjectiveadv, adj | |||||
adverb • in an affable manner | ||||||||
railway | 7 | 13 | nounn | |||||
noun • line that is the commercial organization responsible for operating a system of transportation for trains that pull passengers or freight • a line of track providing a runway for wheels | ||||||||
myalgia | 7 | 13 | nounn | |||||
noun • pain in a muscle or group of muscles | ||||||||
aliyahs | 7 | 13 | nounn | |||||
noun • (Judaism) the honor of being called up to the reading desk in the synagogue to read from the Torah • (Judaism) immigration of Jews to Israel | ||||||||
airplay | 7 | 12 | verb, nounv, n | |||||
noun • The playing of a particular song, band or genre on the radio, or the frequency with which it is played. | ||||||||
aliyah | 6 | 12 | verb, nounv, n | |||||
noun • (Judaism) the honor of being called up to the reading desk in the synagogue to read from the Torah • (Judaism) immigration of Jews to Israel | ||||||||
anality | 7 | 10 | nounn | |||||
Valid word for Scrabble US
| ||||||||
laniary | 7 | 10 | noun, adjectiven, adj | |||||
adjective • of or relating to a pointed conical tooth | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (51)
analysismalaysiacalamityfatalityatypicalraciallyhimalayaamicablybanalityallayinganalyticfaciallyphysaliaalacrityrailyardsalivaryvariablystaysailradiallyaxillaryvaliancycalisayasalacitygalabiyaairplaysmyalgiasaislewaykailyardauralityapicallygraymailnatalityaxialityplagiaryalkalify
...View all with 8 letters...
Phrases (6)
pay claimfile awayhail maryslip awaylay asidelay claimWords (129)
basicallyamazinglypartiallyanalyzingfairytalehimalayasparalysisauxiliarymagicallyradicallyadmiraltymalaysianactualityanalysingchlamydiahimalayanparalyticanimalityvaliantlyfairylandancillarypyramidalamaryllisadmirablycausalitycapillaryrascalityspatiallypapillarycatalyticradiantlycarnalitybabyloniaamblyopiamaximally
...View all with 9 letters...
Phrases (14)
manila bayloya jirgafamily manwhile awaytea familyyam familycalla lilylady's maidblink awaypea family
...View all with 9 letters...
Words (209)
tragicallyyugoslaviacapabilityrationallybabylonianinvariablymaniacallyanalyticalnationallytyrannicaltacticallyhabituallydiagonallymateriallymyocardialalarminglyparalysingmarginallymalignancyabominablyfamiliarlysalicylatealimentarycatalyzingplayactingcharitablyaffabilitybiannuallyhypoplasianauticallyinsatiablymammillaryinvaluablyimplacablyfarcically
...View all with 10 letters...
Phrases (29)
railway carpalm familycall it a daylady godivadaily breadfrivol awayflax familyarum familycavity wallyagi aerial
...View all with 10 letters...
Words (310)
practicallyfinanciallynationalitycalligraphydrasticallyclairvoyantfamiliaritycataclysmicabnormalityapocalypticfranticallyarbitrarilyrationalityfashionablyorganicallyclassicallyerraticallymaterialityyugoslavianappallinglyretaliatoryangelicallyunavoidablyirreparablygraphicallyhypokalemiaaerobicallybotanicallymalignantlyangioplastyinescapablyvariabilitydynamicallyfanaticallysartorially
...View all with 11 letters...
Phrases (82)
grass familylaying claimlaying wastebryonia albaadmiral byrdplaying areaacrylic aciddwindle awaymemorial dayrailway line
...View all with 11 letters...
Words (398)
particularlyaccidentallyoccasionallypennsylvaniadramaticallypassionatelymetaphysicalromanticallyartificiallyparamilitarytransylvaniainflammatorypatheticallyadditionallyavailabilityartisticallyanaphylacticmechanicallyasymmetricalanatomicallyacademicallyunilaterallyemphaticallyclairvoyanceinadequatelyunimaginablyadaptabilityimpartialityimmeasurablyartillerymantheatricallyirrationallypracticalityunmistakablystanislavsky
...View all with 12 letters...
Phrases (130)
visual acuityscantily cladadmiral deweyshaking palsysquirrel awayadmiralty lawphantasy lifeplantain lilymaterial bodyacrylic paint
...View all with 12 letters...
Words (483)
approximatelyautomaticallystatisticallytraditionallyappropriatelyparliamentaryfantasticallysubstantiallyrealisticallystrategicallycategoricallyparadoxicallycomparativelysarcasticallyalternativelypainstakinglyoveranalyzingaestheticallyirrationalityencyclopaediagrammaticallymarketabilitysensationallyparticularityhallucinatoryaffirmativelyhydraulicallytheatricalityhypercalcemiaapplicabilityparabolicallydisparaginglyeducationallypatrioticallyartificiality
...View all with 13 letters...
Phrases (185)
aleatory musicel iskandriyahfamily laridaevaginal arteryfamily picidaein a similar wayadmiralty milefamily poaceaeuranyl radicalcooley's anemia
...View all with 13 letters...
Words (357)
psychoanalysissystematicallymetaphoricallyaffectionatelyaccountabilitydemocraticallymathematicallygeographicallyalphabeticallysustainabilityinterplanetarypathologicallypsychoanalyticgynaecologicalsatisfactorilyembarrassinglymetaphysicallytelepathicallyscholasticallydiplomaticallyastronomicallyappreciativelyidealisticallyaltruisticallyimpracticalityarchetypicallybiographicallydiagnosticallyastrologicallyunavailabilitynymphomaniacalquantitativelyautocraticallybrachycephalicunpalatability
...View all with 14 letters...
Phrases (308)
family apiaceaepearl mae baileywilliam tyndalefamily ardeidaepituitary glandsabbatical yearadmiralty brasscapital of italymaxillary sinusadmiralty metal
...View all with 14 letters...
Words (305)
extraordinarilyinternationallyinstantaneouslyinappropriatelyanaesthesiologycrystallizationparentheticallyaerodynamicallymaneuverabilitycardiopulmonarytherapeuticallycompassionatelylackadaisicallyunparliamentarydramaturgicallyunacceptabilityinspirationallylogarithmicallygastronomicallyauthoritativelyhypochondriacalsympatheticallyarchitecturallydispassionatelydemographicallyheartbreakinglyritualisticallypsychiatricallyaccommodatinglyagranulocytosisapproachabilityunchangeabilitymicroanalyticalalgorithmicallyapocalyptically
...View all with 15 letters...
Phrases (403)
syringa vulgarisalimentary pasteasamiya languagedialysis machinefamily tinamidaefamily lemnaceaefamily arecaceaeby trial and errorfamily leporidaefamily artamidae
...View all with 15 letters...
Words (145)
enthusiasticallycatastrophicallypsychoanalyticaljournalisticallycircumstantiallypharmaceuticallymonosyllabicallyunapologeticallythermostaticallysurrealisticallyphotographicallyparapsychologistconversationallyhypersalivationsparadigmaticallypornographicallyantistrophicallyparamagneticallyradiographicallyparaphrasticallyadministrativelyparapsychologiespolysynapticallymalayo-polynesianarchaeologicallymonosynapticallyarchiepiscopallybureaucraticallyorganizationallyiconoclasticallyiconographicallycrystallizationsunsubstantialitystenographicallycrystallographic
...View all with 16 letters...
Phrases (368)
in a beastly manneritalian greyhoundfamily cyperaceaefamily cyprinidaecapital of hungaryin all probabilitycardiac glycosidein an elaborate waychemical analysispodocarpus family
...View all with 16 letters...
Words (88)
straightforwardlybacteriologicallyanthropologicallymaterialisticallyelectrostaticallythermodynamicallyphilanthropicallyprobabilisticallyantirevolutionaryradiobiologicallycercidiphyllaceaeunexchangeabilitykaleidoscopicallyradioisotopicallyparapsychologistsparasitologicallymonochromaticallyrationalisticallyhypochondriacallypaternalisticallyarchitectonicallyferrimagneticallyunderstandabilitylexicographicallyidiosyncraticallycrystallographiesuntranslatabilitytranscriptionallylymphadenopathieshyperalimentationlymphangiographictransdisciplinarycounterfactualitymacroevolutionaryautocatalytically
...View all with 17 letters...
Phrases (400)
salvia leucophyllabalaena mysticetuspearly everlastingfamily dasypodidaelycopus americanussubphylum craniatamalaysian languagecapital of kentuckycylinder separatorfamily trochilidae
...View all with 17 letters...
Words (41)
characteristicallyhypercoagulabilitypsychopathologicalinterchangeabilitypathophysiologicallaryngopharyngitislipopolysaccharidepostpsychoanalyticlymphangiographiestransformationallycalymmatobacteriumautobiographicallydiethylmalonylurearecrystallizationsmucopolysaccharideophthalmologicallyglycosaminoglycansoscillographicallyspectrographicallyrepresentationallyultracentrifugallymetallographicallyultrarevolutionarypropagandisticallypsychoanalyticallyhydrometallurgicalpsychobiographicalintraventricularlyphysiopathologicaldiethylcarbamazinehyperalimentationssemiquantitativelytachistoscopicallyunenthusiasticallyclaustrophobically
...View all with 18 letters...
Phrases (379)
bombycilla garrulusfamily physeteridaelachrymal secretionnavigational systemfamily trichechidaefamily asparagaceaecommercial activityfamily desmidiaceaemodal auxiliary verbsquirreltail barley
...View all with 18 letters...
Words (33)
cinematographicallyextralinguisticallyextraterritorialityparthenogeneticallynonrelativisticallymucopolysaccharideslipopolysaccharidesconceptualisticallyindividualisticallypharmacodynamicallyphenomenalisticallyphenylthiocarbamidechromatographicallyinterdepartmentallyelectromagneticallyelectromechanicallyhysterosalpingogramanthropocentricallyanthropomorphicallycharacterologicallycortico-hypothalamichistopathologicallyphenylpropanolaminehistoriographicallypsychopharmacologicsymptomatologicallydiethylcarbamazinesphytogeographicallycounterinflationarytetramethyldiarsinepaleogeographicallyelectrocardiographypolychromatophiliasPhrases (356)
water-plantain familyacetylsalicylic acidfamily cyclopteridaefamily cynoglossidaeitalian monetary unitlatvian monetary unitalpine type of glacierphytolacca americanafamily lepisosteidaefamily dasyproctidae
...View all with 19 letters...
Words (23)
uncharacteristicallyoverenthusiasticallytetrahydrocannabinolradioimmunoassayablecrystallographicallylymphogranulomatosismagnetofluiddynamicsphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseneuropsychiatricallyphotoautotrophicallyultramicroscopicallyroentgenographicallyencephalomyocarditischemotherapeuticallypsychopathologicallypsychopharmacologiespsychopharmacologistsyncategorematicallyhypercoagulabilitiesplethysmographicallyexistentialisticallyPhrases (324)
william stanley jevonswyethia amplexicaulisorder mycelia steriliafamily phytolaccaceaemalawian monetary unitlebanese monetary unitorder myxobacterialesfamily trachipteridaemarchantia polymorphabalance sheet analysis
...View all with 20 letters...
Words (11)
psychopharmacologicalhypogammaglobulinemiamucopolysaccharidosisacetylcholinesteraseselectromyographicallyphotolithographicallyantiferromagneticallypsychopharmacologistspsychotherapeuticallyclinicopathologicallytetrahydrocannabinolsPhrases (210)
icelandic monetary unitnikolai rimsky-korsakovaleksandr solzhenitsynmalaysian monetary unithelichrysum bracteatumbulgarian monetary unitsri lankan monetary uniteucalyptus fraxinoidesisle royal national parkcapital of pennsylvania
...View all with 21 letters...
Words (4)
otorhinolaryngologicalhexamethylenetetramineencephalomyocarditisesdihydroxyphenylalaninePhrases (181)
venezuelan monetary unithaliaeetus leucorhyphushydrated aluminium oxidealeksandr i. solzhenitsynfamily dendrocolaptidaesubfamily bassariscidaeguatemalan monetary unitrhythm and blues musicianbrachycome iberidifoliafamily branchiostomidae
...View all with 22 letters...
Words (2)
hexamethylenetetramineshypobetalipoproteinemiaPhrases (124)
family threskiornithidaeposterior pituitary glandyellowstone national parkcalycanthus occidentaliscanyonlands national parkbangladeshi monetary unitrichard brinsley sheridansciadopitys verticillatatricyclic antidepressanteastern malayo-polynesian
...View all with 23 letters...
Words (4)
laryngotracheobronchitishyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolaminePhrases (87)
louis seymour bazett leakeymary wollstonecraft godwinprivately held corporationbrassica oleracea botrytisalexandre emile jean yersinapocynum androsaemifoliumtechnology administrationfederal republic of germanysir charles leonard woolleychrysosplenium americanum
...View all with 24 letters...
Words (1)
phosphatidylethanolaminesPhrases (56)
myroxylon balsamum pereiraefrancis scott key fitzgeraldsymphoricarpos orbiculatuscentral intelligence agencycaulophyllum thalictroidestrans-alaska pipeline systemsir arthur stanley eddingtonconstant of proportionalityreticular activating systemanthony charles lynton blair
...View all with 25 letters...
Phrases (51)
brassica oleracea gongylodessubmandibular salivary glandevelyn arthur saint john waughassyrian neo-aramaic languagecharles maurice de talleyrandrevolutionary calendar monthbureau of diplomatic securityentandrophragma cylindricumbenign prostatic hyperplasiapalestine national authority
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (42)
business environment analysisamerican revolutionary leadergeorge percy aldridge graingeraleksandr sergeyevich pushkinco-operative republic of guyananuclear regulatory commissiontricyclic antidepressant drugjames augustine aloysius joycecryptobranchus alleganiensishyacinthus orientalis albulus
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (29)
aleksandr feodorovich kerenskycardiopulmonary resuscitationdepartment of homeland securitymaster of arts in library sciencedissident irish republican armyrevolutionary communist leaguerevolutionary proletarian armysmall computer system interfacecygnus columbianus columbianusimperial japanese morning glory
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (22)
business environmental analysisaleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderinternational olympic committeemiddle east respiratory syndromehydrangea macrophylla hortensislydia kamekeha paki liliuokalanipresident william henry harrisonnational intelligence community
...View all with 29 letters...
Phrases (23)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library sciencedepository financial institutionethylenediaminetetraacetic acidbalance of international paymentspolymonium caeruleum van-bruntiaecalymmatobacterium granulomatiscalifornia personality inventory
...View all with 30 letters...
Phrases (16)
great smoky mountains national parkdigital communications technologytupac amaru revolutionary movementrevolutionary proletarian nucleusdiego rodriguez de silva y velazquezprimary subtractive color for lightrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyerinternational atomic energy agencymarie anne charlotte corday d'armont
...View all with 31 letters...
Phrases (15)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory druguniversity of california at berkeleyprimary subtractive colour for light
...View all with 32 letters...
Phrases (12)
pityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human serviceshighly active antiretroviral therapyinternational law enforcement agencycapital: critique of political economy
...View all with 33 letters...
Phrases (9)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesmassachusetts institute of technologyeinstein's general theory of relativityeinstein's special theory of relativitycomputerized axial tomography scannerrevolutionary armed forces of colombiaPhrases (9)
communications security establishmentrevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence serviceimmaculate conception of the virgin marynational socialist german workers' partyfraxinus pennsylvanica subintegerrimaunited states naval research laboratoryPhrases (11)
first epistle of paul the apostle to timothyal-jama'a al-islamiyyah al-muqatilah bi-libyauniversity of north carolina at chapel hillgenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratorykarl friedrich hieronymus von munchhausenus army criminal investigation laboratorysixteen personality factor questionnaire
...View all with 37 letters...
Phrases (1)
enzyme-linked-immunosorbent serologic assay